Recombinant Human Mucolipin-2 (MCOLN2)

Shipped with Ice Packs
In Stock

Description

Recombinant Human Mucolipin-2 (MCOLN2): Overview and Classification

Mucolipin-2 (MCOLN2), also known as TRPML2, is a cation channel protein belonging to the transient receptor potential mucolipin-like (TRPML) subfamily of the TRP superfamily. It is encoded by the MCOLN2 gene located on human chromosome 1 and is primarily expressed in immune cells, including macrophages and B cells . Recombinant MCOLN2 refers to the laboratory-produced version of this protein, often engineered for research purposes to study its functional roles in cellular processes such as endosomal trafficking, autophagy, and viral infection .

Recombinant MCOLN2: Production and Research Applications

Recombinant MCOLN2 is typically produced via heterologous expression systems (e.g., mammalian or insect cells) to study its channel activity and interactions. Key applications include:

Viral Entry and Trafficking

MCOLN2 enhances the infection efficiency of late-endosome-dependent viruses by accelerating their transport to late endosomes. Studies using recombinant MCOLN2 demonstrate:

VirusEnhancement EffectMechanism
Influenza A virusIncreased nuclear localization of viral nucleoprotein (NP) .Facilitates endosomal escape via Ca²⁺-dependent trafficking .
Zika virus75% higher infectivity in MCOLN2-expressing cells .Promotes late-endosomal trafficking and cytosolic release .
Yellow fever virusDoubled infectious virus production in MCOLN2-overexpressing cells .Enhances viral RNA replication efficiency .

Limitations: MCOLN2 does not affect viruses entering via plasma membrane fusion (e.g., HIV-1, Coxsackievirus) .

Prostate Cancer Progression

Recombinant MCOLN2 overexpression in prostate cancer (Pca) models reveals its role in tumor growth and metastasis:

PhenotypeMechanismOutcome
ProliferationUpregulation of IL-1β/NF-κB signaling .Enhanced tumor cell survival and invasion .
Bone Lesion DevelopmentIncreased IL-1β secretion drives osteoclast activation .Promotes metastasis to bone in xenograft models .
PrognosisHigh MCOLN2 expression correlates with poor survival in Pca patients .Identified as a potential therapeutic target .

Genetic Variants and Functional Implications

A rare K370Q mutation (rs6704203) in MCOLN2 disrupts its channel activity, rendering it unable to enhance viral infection. This variant is enriched in African populations (11% frequency) and highlights the importance of MCOLN2’s ion-conducting function .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate any specific format requests. Please indicate your preferred format when placing your order, and we will prepare accordingly.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery times.
Note: Our default shipping method includes normal blue ice packs. If dry ice shipping is required, please inform us in advance, as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, we suggest briefly centrifuging the vial prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can serve as a reference.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the intrinsic stability of the protein.
Generally, liquid formulations have a shelf life of 6 months at -20°C/-80°C. Lyophilized formulations have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
While the tag type is determined during production, we are open to accommodating your specific tag type requests. Please inform us of your desired tag type, and we will prioritize its development.
Synonyms
MCOLN2; Mucolipin-2; Transient receptor potential channel mucolipin 2; TRPML2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-566
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
MCOLN2
Target Protein Sequence
MARQPYRFPQARIPERGSGVFRLTVRNAMAHRDSEMKEECLREDLKFYFMSPCEKYRARR QIPWKLGLQILKIVMVTTQLVRFGLSNQLVVAFKEDNTVAFKHLFLKGYSGTDEDDYSCS VYTQEDAYESIFFAINQYHQLKDITLGTLGYGENEDNRIGLKVCKQHYKKGTMFPSNETL NIDNDVELDCVQLDLQDLSKKPPDWKNSSFFRLEFYRLLQVEISFHLKGIDLQTIHSREL PDCYVFQNTIIFDNKAHSGKIKIYFDSDAKIEECKDLNIFGSTQKNAQYVLVFDAFVIVI CLASLILCTRSIVLALRLRKRFLNFFLEKYKRPVCDTDQWEFINGWYVLVIISDLMTIIG SILKMEIKAKNLTNYDLCSIFLGTSTLLVWVGVIRYLGYFQAYNVLILTMQASLPKVLRF CACAGMIYLGYTFCGWIVLGPYHDKFENLNTVAECLFSLVNGDDMFATFAQIQQKSILVW LFSRLYLYSFISLFIYMILSLFIALITDSYDTIKKFQQNGFPETDLQEFLKECSSKEEYQ KESSAFLSCICCRRRKRSDDHLIPIS
Uniprot No.

Target Background

Function
Mucolipin-2 (MCOLN2) is a nonselective cation channel that plays a crucial role in regulating membrane trafficking events. It functions as a Ca(2+)-permeable cation channel with inwardly rectifying activity, potentially activating ARF6 and participating in the trafficking of GPI-anchored cargo proteins to the cell surface via the ARF6-regulated recycling pathway. MCOLN2 may also be involved in immune processes. In adaptive immunity, it may have redundant roles with TRPML1 in the function of specialized lysosomes within B cells. In innate immunity, it might regulate chemokine secretion and macrophage migration. Through possible, and likely tissue-specific, heteromerization with MCOLN1, MCOLN2 may contribute to various lysosome-dependent cellular events.
Gene References Into Functions
  1. High TRPML-2 expression in glioma cells has been linked to increased survival and proliferation signaling, suggesting a pro-tumorigenic role in glioma progression. PMID: 27248469
  2. MCOLN2 is transcriptionally activated by PAX5 and plays significant roles in B cell development and function. PMID: 25445271
  3. TRPML2 is activated by reducing extracellular sodium concentration, as well as by specific small chemical compounds previously identified as activators of TRPML3. PMID: 22753890
  4. TRPML 1, 2, and 3 assemblies regulate cell viability and starvation-induced autophagy. PMID: 20736310
  5. Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator) PMID: 20379614
  6. Constitutively active h-TRPML2 leads to cell death by causing Ca(2+) overload. PMID: 19940139
  7. There is a hierarchical control over the subcellular distribution of TRPMLs, where TRPML1 and TRPML2 determine the localization of TRPML3, not vice versa. PMID: 16606612
  8. MCOLN2 traffics through the ADP-ribosylation factor 6 (Arf6)-associated pathway, colocalizing with major histocompatibility protein class I and CD59 in long recycling endosomes. PMID: 17662026
  9. TRPML1 appears to play a novel role in the tissue-specific transcriptional regulation of TRPML2. PMID: 19763610
  10. Data indicate that TRPMLs form distinct functional channel complexes. PMID: 19885840

Show More

Hide All

Database Links

HGNC: 13357

OMIM: 607399

KEGG: hsa:255231

STRING: 9606.ENSP00000359640

UniGene: Hs.591446

Protein Families
Transient receptor (TC 1.A.4) family, Polycystin subfamily, MCOLN2 sub-subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein. Late endosome membrane; Multi-pass membrane protein. Lysosome membrane; Multi-pass membrane protein. Recycling endosome membrane; Multi-pass membrane protein.

Q&A

What is the molecular structure of human MCOLN2?

MCOLN2 belongs to the transient receptor potential (TRP) protein superfamily, functioning as a gated tetrameric cation channel. The protein shares a conserved structure of six transmembrane helices with cytoplasmic-oriented N- and C-terminal domains . In humans, the canonical protein has a reported length of 566 amino acid residues and a mass of 65.9 kDa . MCOLN2 is primarily localized in endosomes, where it plays key roles in vesicular trafficking, autophagy, and membrane fusion, distinguishing it from most TRP proteins that localize to the plasma membrane .

What are the primary physiological functions of MCOLN2?

MCOLN2 is believed to be primarily localized in recirculating endosomes and plays a significant role in the Arf6-associated recycling pathway . Studies have demonstrated its importance in immunity, particularly in the regulation of chemokine secretion and macrophage recruitment during inflammatory responses . In a mouse model, MCOLN2 knockdown resulted in impaired secretion of chemokines (especially CCL2) and reduced recruitment of peripheral macrophages following bacterial challenge, suggesting a critical role in innate immune responses .

Where is MCOLN2 predominantly expressed in human and mouse tissues?

MCOLN2 exhibits tissue-specific expression, being predominantly expressed in lymphoid organs (particularly thymus and spleen) and kidney . This restricted expression pattern differentiates it from MCOLN1, which is widely expressed in many tissues . Quantitative RT-PCR analysis has revealed that MCOLN2 is mainly expressed in immune cells, with expression levels tightly regulated at the transcriptional level .

How is MCOLN2 expression regulated in immune cells?

MCOLN2 expression is negligible in resting macrophages but dramatically increases in response to toll-like receptor (TLR) activation both in vitro and in vivo . It is an interferon-stimulated gene induced in mouse macrophages in response to lipopolysaccharide (LPS) . The B cell transcription factor PAX5 has also been found to promote MCOLN2 expression . This tight transcriptional control suggests MCOLN2 plays a specific role during immune activation, unlike MCOLN1 and MCOLN3, whose expression levels do not change upon TLR activation .

How does MCOLN2 differ from other members of the TRPML family?

The TRPML family contains three members: MCOLN1, MCOLN2, and MCOLN3. While all share structural similarities, they differ in their expression patterns and subcellular localization:

FeatureMCOLN1MCOLN2MCOLN3
ExpressionWidely expressed in many tissuesPredominantly in lymphoid and myeloid tissuesVaried but limited set of tissues
Subcellular LocalizationLate endosomes/lysosomesRecycling endosomes, lysosomes, plasma membraneEarly endosomal pathway
Associated ConditionsMucolipidosis type IV (MLIV)Recently linked to neurological symptomsVaritint-waddler mouse phenotypes
Regulation during Immune ResponseNo change upon TLR activationDramatically increases upon TLR activationNo change upon TLR activation

This distinct subcellular distribution suggests specialized functions for each TRPML family member in the endosomal-lysosomal system .

Can MCOLN2 functionally complement deficiencies in other TRPML proteins?

Research suggests potential functional redundancy between TRPML proteins, which could be exploited as a therapeutic strategy for MLIV disease . Evidence indicates that MCOLN2 expression may complement certain phenotypic alterations in MLIV cells, though challenges in functional complementation remain . Homomeric TRPML2 ion channels within the plasma membrane have unique channel properties that could serve a completely different function than heteromeric TRPML2-TRPML1 channels possibly detected in the lysosomes of certain immune system cells .

What techniques are most effective for detecting MCOLN2 expression?

Several experimental approaches can be employed to detect and analyze MCOLN2:

  • Protein Detection: Western Blot is widely used, along with Immunocytochemistry, Immunofluorescence, and Immunohistochemistry using anti-MCOLN2 antibodies .

  • Transcriptional Analysis: Quantitative RT-PCR is particularly valuable for analyzing MCOLN2 expression levels, especially given its tight transcriptional regulation .

  • Functional Assessment: Electrophysiological recordings can confirm MCOLN2 presence in the plasma membrane following exposure to specific small molecule agonists such as SF-21, SF-41, and SF-81 .

  • Localization Studies: Immunofluorescence analysis with markers for different endosomal compartments can determine MCOLN2's precise subcellular distribution .

What controls should be included when studying MCOLN2 in experimental settings?

When studying MCOLN2, researchers should include several controls:

  • Expression Controls: Compare MCOLN2 expression in activated vs. resting immune cells, as expression is dramatically upregulated upon activation .

  • Specificity Controls: Include MCOLN1 and MCOLN3 analyses to confirm specificity of effects, as these related channels show different regulation patterns .

  • Localization Controls: Use established markers for recycling endosomes (primary MCOLN2 location) vs. late endosomes/lysosomes (MCOLN1) and early endosomes (MCOLN3) .

  • Functional Controls: When using MCOLN2 knockout models, include rescue experiments with wild-type MCOLN2 to confirm phenotype specificity .

How does MCOLN2 contribute to innate immune responses?

MCOLN2 plays a critical role in the innate immune response, particularly in chemokine production and macrophage recruitment . Studies have shown that:

  • MCOLN2 is an interferon-stimulated gene that is highly induced following TLR activation .

  • In MCOLN2-knockout mice, production of several chemokines, particularly CCL2, was severely reduced .

  • MCOLN2-knockout mice displayed impaired recruitment of peripheral macrophages in response to intraperitoneal injections of LPS or live bacteria, suggesting a defect in immune response .

  • The B cell transcription factor PAX5 promotes MCOLN2 expression, suggesting additional roles in adaptive immunity .

What experimental approaches best elucidate MCOLN2's function in immune cells?

To investigate MCOLN2's role in immune function, researchers can employ:

  • Genetic Manipulation: MCOLN2-knockout or knockdown models to assess immune responses to pathogens .

  • Functional Assays: Chemokine secretion assays in wild-type vs. MCOLN2-deficient cells following immune stimulation .

  • Migration Studies: Macrophage recruitment assays comparing wild-type and MCOLN2-deficient conditions .

  • In vivo Models: Challenge with LPS or live bacteria to assess immune recruitment and pathogen clearance in the presence or absence of MCOLN2 .

  • Transcriptomics: Analysis of gene expression changes in immune cells with altered MCOLN2 expression to identify downstream pathways .

What expression systems are optimal for producing recombinant human MCOLN2?

For recombinant MCOLN2 expression, researchers should consider:

  • Expression System Selection: Mammalian cell lines (HEK293, CHO) are preferred for proper post-translational modifications and folding of this multi-pass membrane protein .

  • Construct Design: Include appropriate tags (His, FLAG) for purification and detection while ensuring they don't interfere with channel function or localization .

  • Codon Optimization: Optimize codons for the chosen expression system to enhance protein yield.

  • Induction Conditions: For inducible systems, determine optimal induction parameters (concentration, timing, temperature) to maximize functional protein expression.

  • Solubilization Strategies: Develop appropriate detergent or lipid-based solubilization protocols to maintain channel structure during purification .

What challenges are commonly encountered when expressing recombinant MCOLN2?

Researchers face several challenges when working with recombinant MCOLN2:

  • Protein Misfolding: As a multi-pass membrane protein, MCOLN2 is prone to misfolding when overexpressed, potentially requiring chaperone co-expression.

  • Toxicity: Overexpression of ion channels can disrupt cellular ion homeostasis, leading to toxicity in the expression system.

  • Low Yield: Membrane proteins typically express at lower levels than soluble proteins, necessitating optimization of culture conditions.

  • Functional Verification: Confirming that recombinant MCOLN2 maintains native channel properties requires specialized electrophysiological or ion flux assays .

  • Subcellular Mislocalization: Overexpressed MCOLN2 may not traffic properly to its native endosomal locations, requiring verification of proper localization .

What is known about MCOLN2's involvement in human disease?

Recent findings have linked MCOLN2 to potential pathological conditions:

  • Compound heterozygous changes in the MCOLN2 gene were identified in a UDN participant with seizures, developmental regression, and abnormal muscle tone .

  • Unlike MCOLN1, which is associated with Mucolipidosis type IV, MCOLN2 has not been extensively linked to any specific human disease until recently .

  • The specific molecular mechanisms by which MCOLN2 mutations might contribute to neurological symptoms remain to be elucidated, opening new research directions .

What research approaches can further elucidate MCOLN2's role in disease?

To investigate MCOLN2's involvement in pathological conditions, researchers can:

  • Genetic Screening: Conduct targeted sequencing of MCOLN2 in patients with unexplained neurological disorders, particularly those with seizures and developmental issues .

  • Animal Models: Develop transgenic animals harboring specific MCOLN2 mutations identified in patients to study phenotypic consequences .

  • Patient-Derived Cells: Generate induced pluripotent stem cells (iPSCs) from affected individuals and differentiate them into relevant cell types to study disease mechanisms.

  • Structure-Function Analysis: Investigate how specific mutations affect MCOLN2 channel properties, localization, and interaction with binding partners .

  • Therapeutic Approaches: Explore whether modulating MCOLN2 function using specific agonists could ameliorate symptoms in affected individuals .

How does MCOLN2 coordinate with the vesicular trafficking machinery?

MCOLN2 is believed to be primarily localized in recycling endosomes and plays a role in the Arf6-associated recycling pathway . To investigate this coordination:

  • Interactome Analysis: Employ proximity labeling techniques (BioID, APEX) to identify proteins in close proximity to MCOLN2 within endosomes.

  • Live Cell Imaging: Use fluorescently tagged MCOLN2 alongside markers for different endosomal compartments to track dynamic interactions during trafficking events.

  • Cargo Trafficking Assays: Measure transport kinetics of model cargoes in wild-type vs. MCOLN2-deficient cells to quantify trafficking defects.

  • Structure-Function Studies: Identify MCOLN2 domains critical for interaction with trafficking machinery through mutagenesis approaches.

What are the molecular mechanisms by which MCOLN2 regulates chemokine secretion?

MCOLN2 knockdown results in impaired secretion of chemokines, particularly CCL2 , but the precise mechanisms remain unclear. Researchers can explore:

  • Ca²⁺ Signaling: Investigate how MCOLN2-mediated calcium flux affects vesicle fusion events during chemokine secretion.

  • Secretory Pathway Analysis: Determine whether MCOLN2 affects chemokine trafficking through the conventional or unconventional secretory pathway.

  • Transcriptional Effects: Analyze whether MCOLN2 influences chemokine production at the transcriptional level in addition to secretion.

  • Signaling Crosstalk: Explore how MCOLN2 activity interfaces with other signaling pathways activated during immune responses.

What emerging technologies could advance our understanding of MCOLN2 function?

Several cutting-edge approaches could significantly enhance MCOLN2 research:

  • Cryo-EM Structural Analysis: Determine the high-resolution structure of MCOLN2 to understand its gating mechanisms and interaction surfaces.

  • Optogenetic Control: Develop light-sensitive MCOLN2 variants to precisely control channel activity in specific subcellular compartments.

  • Single-Molecule Tracking: Apply super-resolution microscopy to track individual MCOLN2 channels during vesicular trafficking events.

  • Tissue-Specific Conditional Knockouts: Generate models with immune cell-specific MCOLN2 deletion to dissect cell-autonomous functions.

  • CRISPR-Mediated Endogenous Tagging: Insert fluorescent or affinity tags into the endogenous MCOLN2 locus to study the protein at physiological expression levels.

How might therapeutic targeting of MCOLN2 be approached in future research?

Given MCOLN2's roles in immune function and potential involvement in neurological conditions, therapeutic approaches might include:

  • Small Molecule Modulators: Develop specific agonists or antagonists that can modify MCOLN2 channel activity in disease states .

  • Gene Therapy: For loss-of-function mutations, explore viral vector-mediated delivery of functional MCOLN2.

  • Complementation Strategies: Investigate whether overexpression of other TRPML family members could compensate for MCOLN2 deficiency in certain contexts .

  • Immunomodulatory Applications: Given MCOLN2's role in chemokine secretion, explore its targeting in conditions with excessive immune activation .

  • Biomarker Development: Assess whether MCOLN2 expression or activity could serve as a biomarker for certain immune or neurological conditions .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.