Recombinant Human Muscarinic acetylcholine receptor M1 (CHRM1)

Shipped with Ice Packs
In Stock

Description

Basic Characteristics of CHRM1

PropertyDetails
GeneCHRM1 (chromosome 11q13)
Protein Length460 amino acids
Transmembrane Domains7 domains
UniProt IDP11229
AliasesM1, HM1, M1R
Subcellular LocalizationPlasma membrane, postsynaptic density, mitochondrial membrane (in neurons)

CHRM1 belongs to the muscarinic acetylcholine receptor family and couples primarily to Gq/11 proteins, activating phospholipase C (PLC) to increase intracellular calcium and phosphoinositide turnover . It also modulates potassium channels and inhibits adenylate cyclase in certain contexts .

Functional Roles and Signaling Pathways

CHRM1 mediates diverse physiological processes:

  • Central Nervous System (CNS):

    • Modulates cognition, memory, synaptic plasticity, and anxiety-like behaviors .

    • Regulates dopamine release in the striatum, influencing locomotor activity .

  • Peripheral Nervous System (PNS):

    • Controls vagally-induced bronchoconstriction, gastrointestinal acid secretion, and smooth muscle contraction .

  • Mitochondrial Interaction:

    • Co-localizes with mitochondria in neurons, impacting mitochondrial structure and function .

Key Signaling Pathways:

PathwayMechanism
Gq/11-PLC AxisActivates PLC → IP3 release → ER calcium mobilization → PKC activation .
G Protein/ArrestinPhosphorylation-dependent internalization linked to neuroprotection .
MAP KinaseModulates ERK1/2 and p38 MAPK in colon cancer cells .

Neurological Disorders

  • Alzheimer’s Disease (AD):

    • CHRM1 agonists improve cognitive deficits in AD models but cause side effects (e.g., hallucinations) .

    • Phosphorylation-dependent CHRM1 signaling is neuroprotective, reducing neuroinflammation and prion-induced neurodegeneration .

  • Prion Disease:

    • Mice lacking CHRM1 phosphorylation sites exhibit accelerated neurodegeneration, highlighting its role in slowing disease progression .

Oncology

  • Colon Cancer:

    • CHRM1 expression is reduced in colon cancer, while CHRM3 is upregulated .

    • Selective CHRM1 agonists (e.g., McN-A-343) inhibit colon cancer cell proliferation by targeting EGFR/ERK/p38 pathways .

    • Synergistic effects with chemotherapy (e.g., 5-FU) enhance antitumor efficacy .

Pharmacological Studies

  • Drug Development:

    • Recombinant CHRM1 is used to screen agonists/antagonists in calcium flux assays (e.g., EC50 values for carbamoylcholine: 157–1,700 nM) .

    • Pirenzepine (antagonist) exhibits IC50 values of 7.4–22 nM in radioligand binding assays .

Neuroprotection in Neurodegenerative Diseases

  • Prion Disease Model:

    • CHRM1-PD (phosphorylation-deficient) mice show rapid neurodegeneration and reduced lifespan .

    • Receptor phosphorylation/arrestin signaling suppresses neuroinflammation and extends survival .

Colon Cancer Therapy

  • CHRM1 vs. CHRM3:

    • CHRM1 activation inhibits proliferation, while CHRM3 activation promotes it .

    • Selective CHRM1 agonists (e.g., 77-LH-28-1) outperform conventional chemotherapy in inhibiting SW620 colon cancer cells .

Mitochondrial Localization

  • Peripheral Neurons:

    • CHRM1 co-localizes with mitochondria in dorsal root ganglion neurons, and its loss disrupts mitochondrial ultrastructure .

Challenges and Future Directions

ChallengePotential Solution
Side EffectsDesigning biased agonists favoring arrestin signaling over Gq/11 .
Partial FragmentsEnhancing mammalian expression systems for full-length CHRM1 .
Therapeutic EfficacyCombining CHRM1 agonists with chemotherapy for colon cancer .

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format that is currently in stock. However, if you have specific requirements for the format, please indicate them in your order notes, and we will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery timeframes, please consult your local distributors.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. We advise storing working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is dependent on several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize its development accordingly.
Synonyms
CHRM1; Muscarinic acetylcholine receptor M1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-460
Protein Length
Full length protein
Species
Homo sapiens (Human)
Target Names
Target Protein Sequence
MNTSAPPAVSPNITVLAPGKGPWQVAFIGITTGLLSLATVTGNLLVLISFKVNTELKTVN NYFLLSLACADLIIGTFSMNLYTTYLLMGHWALGTLACDLWLALDYVASNASVMNLLLIS FDRYFSVTRPLSYRAKRTPRRAALMIGLAWLVSFVLWAPAILFWQYLVGERTVLAGQCYI QFLSQPIITFGTAMAAFYLPVTVMCTLYWRIYRETENRARELAALQGSETPGKGGGSSSS SERSQPGAEGSPETPPGRCCRCCRAPRLLQAYSWKEEEEEDEGSMESLTSSEGEEPGSEV VIKMPMVDPEAQAPTKQPPRSSPNTVKRPTKKGRDRAGKGQKPRGKEQLAKRKTFSLVKE KKAARTLSAILLAFILTWTPYNIMVLVSTFCKDCVPETLWELGYWLCYVNSTINPMCYAL CNKAFRDTFRLLLLCRWDKRRWRKIPKRPGSVHRTPSRQC
Uniprot No.

Target Background

Function
The muscarinic acetylcholine receptor mediates various cellular responses, including inhibition of adenylate cyclase, breakdown of phosphoinositides, and modulation of potassium channels through the action of G proteins. The primary transducing effect is phosphatidylinositol (Pi) turnover.
Gene References Into Functions
  1. The study focused on the human mAChR1 receptor, for which a presumably reliable model was generated using the congener mAChR3 as the template. Additionally, a second, less reliable model was developed based on the distant beta2-AR template. This second model was then used to produce chimeras by combining the conformations of its Pro-containing helices (TM4, TM5, TM6, and TM7) resulting in 16 modeled chimeras. PMID: 27490167
  2. The discovery of a receptor homolog of human mAChR1 on Acanthamoeba suggests a potential role for this receptor in the biology of this protist pathogen. Future studies are planned to investigate its expression and binding to cholinergic agonist and antagonist. PMID: 27601178
  3. Receptor species-dependent desensitization controls KCNQ1/KCNE1 K+ channels as downstream effectors of Gq protein-coupled receptors. (PMID: 27834678
  4. No significant associations were found between CHRM1 SNPs and autonomic nervous system activity in patients with schizophrenia receiving high-dose antipsychotics. PMID: 27923235
  5. Changes in membrane cholesterol concentration differentially impact preferential and non-preferential M1 and M3 receptor signaling. PMID: 24821386
  6. The rs2067477 muscarinic M1 receptor genotype is associated with grey matter volume in schizophrenia. PMID: 26481978
  7. Crystal structures of the M1 and M4 muscarinic receptors bound to the inverse agonist, tiotropium, have been determined. PMID: 26958838
  8. This study highlights how affinity and cooperativity properties can be differentially modified on a common structural scaffold. It also identifies molecular features that can be exploited for the development of M1 mAChR-targeting positive allosteric modulators (PAMs). PMID: 25326383
  9. CHRM2, but not CHRM1 or CHRM3, polymorphisms are associated with asthma susceptibility in Mexican patients. PMID: 24430298
  10. The levels were comparable for complexes containing GluR2, GluR3, and GluR4, as well as 5-HT1A. Additionally, the levels of complexes containing muscarinic AChR M1, NR1, and GluR1 were significantly increased in male patients with Alzheimer's disease (AD). PMID: 24292102
  11. This study demonstrates that BQCA potentiates agonist-induced beta-arrestin recruitment to M1 mAChRs. PMID: 24753247
  12. In patients with schizophrenia, both cell body staining and elevated M1 muscarinic receptor reactivity correlated with higher symptom scores. PMID: 24636402
  13. This research demonstrates that activation of the M1 muscarinic acetylcholine receptor augments the restitution of epithelial barrier function in T84 cell monolayers after ethanol-induced epithelial injury, via ERK-dependent phosphorylation of focal adhesion kinase. PMID: 24365239
  14. Mutation of amino acid residues that form the orthosteric binding pocket resulted in a loss of carbachol response, which could be rescued by BQCA. PMID: 24443568
  15. The findings indicate that downregulation of cholinergic receptor M1 by histone H3K9me3 impairs calcium signaling and contributes to the pathogenesis of Huntington's disease. PMID: 23455440
  16. Decreased muscarinic M1 receptor radioligand binding has been observed in the cerebral cortex of schizophrenic patients. PMID: 22338582
  17. M1-mAChRs function at both surface and intracellular sites in telencephalon neurons, including the hippocampus. PMID: 23678982
  18. The fluorescent compounds inherit bitopic properties from a linker-guided positioning of their Bodipy moiety within the M1 allosteric vestibule. PMID: 23604140
  19. Autoantibodies purified from the sera of breast cancer patients activate muscarinic acetylcholine receptors in tumor cells. PMID: 23460876
  20. A breakdown in gene promoter methylation control of CHRM1 expression contributes to the global pathophysiology of schizophrenia. PMID: 23423139
  21. These results suggest a complex antagonistic interplay between G(q)-activated PKC and Gbetagamma in regulation of L-VDCC, involving multiple cytosolic segments of alpha(1C). PMID: 22990911
  22. Collectively, these findings demonstrate that SOD1 could activate a transductional pathway involving the M1 muscarinic receptor. PMID: 23147108
  23. These data indicate that EGFR and PKC are involved in mAChR-mediated activation of ERK1/2 and RSK, and the subsequent proliferation of SNU-407 colon cancer cells. PMID: 22865467
  24. CHRM1 sequence is associated with alterations in certain aspects of executive function. Post-mortem studies suggest that these alterations are not solely due to changes in mRNA expression levels, indicating that sequence variation may impact CHRM1 functionality. PMID: 22391213
  25. This research found that the M1 muscarinic acetylcholine receptor (M1 mAChR), a crucial G protein-coupled receptor involved in cholinergic neuronal activity, can interact with BACE1 and mediate its proteosomal degradation. PMID: 22450048
  26. The binding mode of MT7 and human muscarinic acetylcholine receptor 1 consists of three interaction regions within five residue interaction clusters. PMID: 22571431
  27. Binding properties of the human muscarinic M1 receptor in stably transfected Chinese hamster ovary cells are significantly enhanced after supplementation, likely by facilitating receptor-mediated G protein activation. PMID: 22146060
  28. Docking calculations structurally support the high affinity and selectivity of the MT7-human M1 muscarinic receptor interaction and highlight the atypical mode of interaction of this allosteric ligand on its G protein-coupled receptor target. PMID: 21685390
  29. Analysis of the long-term effects of xanomeline on the M(1) muscarinic acetylcholine receptor. PMID: 21203415
  30. Distribution of M1 receptors in the human colon. PMID: 20146726
  31. The M1 receptor plays a significant role in the maintenance of retinal pigment epithelium function. PMID: 17415969
  32. Data demonstrate that two-color total internal reflection fluorescence microscopy (TIRFM) established the dynamic nature of dimer formation with M(1) receptors undergoing interconversion between monomers and dimers on the timescale of seconds. PMID: 20133736
  33. Increased inattention scores (Conners' teacher-rating scale) and lower l-MR associated with increased scores for oppositional-defiant disorder. PMID: 19863190
  34. This study demonstrated that, in a subgroup of subjects with schizophrenia, there was a decrease in cortical muscarinic acetylcholine receptor M1. PMID: 18317461
  35. Muscarinic cholinoceptor activation by pilocarpine triggers apoptosis in human skin fibroblast cells. PMID: 19927300
  36. Fifteen single nucleotide polymorphisms (SNPs) of CHRM1 have been discovered, nine of which are located in the coding region of the receptor. Of these, eight represent synonymous SNPs, indicating that CHRM1 is highly conserved in humans. PMID: 12049494
  37. A 28% decrease in post-mortem levels of steady-state cortical muscarinic 1 receptor cDNA has been observed in schizophrenia patient samples compared to controls. PMID: 12707929
  38. The role of M1 and M2 muscarinic receptors expressed by human L cells in the control of GLP-1 secretion. PMID: 12810581
  39. In conclusion, autoantibodies to CHRM1 were detected in a significant number of Chronic Fatigue Syndrome (CFS) patients and were associated with CFS symptoms. PMID: 12851722
  40. M1- and M3-, but not M2- or M4-AchR, signals activate HIF-1 through both stabilization and synthesis of HIF-1alpha, and by inducing the transcriptional activity of HIF-1alpha. PMID: 15280370
  41. Muscarinic acetylcholine receptor-1 mRNA is expressed in human scleral fibroblasts. PMID: 16318751
  42. All three of the Kir2 channels are similarly inhibited by m1 muscarinic receptor stimulation through calcium-dependent activation of the small GTPase Rho. PMID: 16328454
  43. Increased phosphorylation of M1 and M2 mAChRs underlies their sequestration after transient hypoxia. Distinct pathways involving CK1alpha and GRK2 mediate the sequestration of M1 and M2 mAChRs following transient hypoxic-induced oxidative stress. PMID: 16336219
  44. Data demonstrate that muscarinic acetylcholine receptors (mAChRs), including M(1), M(2), and M(3), can form homo- and heterodimers in living cells. This suggests that heterodimerization plays a role in the long-term regulation of mAChRs. PMID: 16368694
  45. Data show that intracellular zinc uptake in SK-SH-SY5Y cells is controlled by M1-mAChR mediated signaling pathways. Zinc may act as a cofactor for transcriptional regulation of zinc finger genes, such as PNUTS. PMID: 16406470
  46. MT7 toxin interacts with the hM1 receptor at a specific allosteric site, which may partially overlap those identified previously for "classic" or "atypical" allosteric agents. PMID: 16439611
  47. Association of the nicotinic acetylcholine receptor beta1 subunit (CHRNB1) and M1 muscarinic acetylcholine receptor (CHRM1) with vulnerability for nicotine dependence. PMID: 16874522
  48. mAChR subtypes (m1 to m5) are present in human scleral fibroblasts at both mRNA and protein levels. PMID: 16877267
  49. This study provides structural insight for a better understanding of the M1 receptor and its binding sites. PMID: 16902941
  50. The gene coding for the human cholinergic receptor muscarinic-1 is an important susceptibility locus for asthma at chromosome 11q13. PMID: 16931638

Show More

Hide All

Database Links

HGNC: 1950

OMIM: 118510

KEGG: hsa:1128

STRING: 9606.ENSP00000306490

UniGene: Hs.632119

Protein Families
G-protein coupled receptor 1 family, Muscarinic acetylcholine receptor subfamily, CHRM1 sub-subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein. Cell junction, synapse, postsynaptic cell membrane; Multi-pass membrane protein.

Q&A

What is the Muscarinic Acetylcholine Receptor M1 (CHRM1) and what is its primary function in the nervous system?

CHRM1 is a G protein-coupled receptor that plays crucial roles in cholinergic neurotransmission. It primarily couples to Gαq/11 proteins to initiate signal transduction pathways, particularly in cortical neurons . CHRM1 is essential for modulating cortical-subcortical communication and is significantly involved in working memory processes that require cortical and hippocampal engagement . Recent studies have also revealed a previously unknown association between CHRM1 and mitochondrial function, suggesting its involvement in cellular energetics beyond traditional receptor signaling roles .

How is CHRM1 typically expressed in the human brain?

CHRM1 shows distinct expression patterns across various brain regions. It is prominently expressed in the:

  • Dorsolateral prefrontal cortex (Brodmann area 9)

  • Cortical laminae V, specifically in pyramidal neurons that facilitate cortical-subcortical communication

  • Hippocampus

  • Peripheral nervous system, including dorsal root ganglion (DRG) neurons

The receptor's expression is significantly altered in neurological conditions, with markedly lower levels observed in patients with Alzheimer's disease and a subpopulation of patients with schizophrenia .

What methods are commonly used to detect and quantify CHRM1 expression?

Several complementary approaches are used to study CHRM1 expression:

TechniqueApplicationAdvantage
[³H]-Pirenzepine bindingReceptor density quantificationProvides quantitative measure of binding sites
Fluorescent protein tagging (GFP/RFP)Localization studiesEnables live-cell visualization
ImmunoblottingProtein level detectionQuantifies total and post-translationally modified proteins
Confocal time-lapse imagingDynamic localizationTracks receptor movement in living cells
Transmission electron microscopyUltrastructural localizationIdentifies subcellular distribution

When analyzing CHRM1 in human tissues, it's important to note that antibody reactivity patterns may differ between human and mouse tissues, potentially due to species-specific post-translational modifications .

What is the relationship between CHRM1 and mitochondrial function?

Recent evidence has established a direct relationship between CHRM1 and mitochondrial function:

  • Fluorescence imaging reveals colocalization and comigration of N-terminal GFP-tagged CHRM1 with mitochondria in neurons

  • CHRM1 protein is significantly enriched (2-3 fold) in mitochondrial fractions compared to total tissue lysates

  • Loss of CHRM1 leads to significant reduction in mitochondrial respiration (oxygen consumption) and disruption of mitochondrial ultrastructure

  • CHRM1 deletion causes reduced oligomerization of ATP synthase (complex V) and impaired assembly of respiratory chain supercomplexes (respirasomes)

  • Conversely, overexpression of CHRM1 in cells lacking the native receptor increases complex V oligomerization and respirasome assembly, enhancing respiration

These findings indicate that CHRM1 plays a previously unrecognized role in maintaining mitochondrial structural and functional integrity, potentially explaining some of the energetic deficits observed in disorders with reduced CHRM1 expression .

How does CHRM1 expression change in neurodegenerative diseases?

Significant alterations in CHRM1 expression have been documented in neurodegenerative conditions:

In Alzheimer's disease:

  • Significantly lower CHRM1 protein levels in cortical tissues of AD patients

  • Reduced CHRM1 levels correlate with decreased patient survival

  • The connection between CHRM1 loss and mitochondrial dysfunction provides a potential mechanistic link to AD pathogenesis

In schizophrenia:

  • A subpopulation of patients ("muscarinic receptor-deficit schizophrenia" or MRDS) shows 60-80% reduction in cortical CHRM1 binding

  • This reduction specifically affects CHRM1 but not other muscarinic receptor subtypes like CHRM2/CHRM3 or CHRM4

  • Patients with schizophrenia show loss of CHRM1-positive pyramidal neurons in cortical laminae V, crucial for cortical-subcortical communication

These findings suggest that targeting CHRM1 might represent a therapeutic approach for both conditions, though through potentially different mechanisms .

What structural and functional changes occur in mitochondria when CHRM1 is deleted?

CHRM1 deletion causes dramatic mitochondrial abnormalities at both structural and functional levels:

Structural changes:

  • Disruption and loss of cristae in 87% of neurons in CHRM1-/- dorsal root ganglia

  • Altered tinctorial properties of cortical neurons with significant increase in dark neurons (85% in CHRM1-/- vs. 2% in wild-type)

  • Impaired supramolecular assembly of respiratory chain complexes

Functional changes:

  • Significantly reduced cortical mitochondrial respiration

  • Decreased proton leak across the inner mitochondrial membrane

  • Altered respiratory control ratio (RCR), though this appears to result from decreased proton leak rather than improved efficiency

  • Impaired electron flow through the respiratory chain complexes

These findings reveal that CHRM1 is essential for maintaining proper mitochondrial structure and function, with its loss leading to severe mitochondrial dysfunction that may contribute to neuronal impairment .

How do changes in CHRM1-G protein coupling efficiency contribute to schizophrenia pathophysiology?

A fascinating compensatory mechanism has been identified in muscarinic receptor-deficit schizophrenia (MRDS) patients:

  • Despite 60-80% reduction in CHRM1 expression, the efficacy of CHRM1-Gαq/11 coupling is actually increased

  • This represents an adaptive change in receptor-G protein coupling efficiency

  • The potency of CHRM agonists (measured by pEC₅₀) is decreased in MRDS, but the maximal signaling response is preserved or enhanced

  • Both orthosterically and allosterically acting CHRM agonists can still stimulate receptor-driven functional responses in membranes from MRDS patients

This compensatory upregulation of coupling efficiency may represent an attempt to maintain cholinergic signaling despite reduced receptor availability. This finding has important implications for therapeutic approaches, suggesting that targeting receptor coupling mechanisms rather than simply increasing receptor expression might be beneficial in this subgroup of patients .

What mechanisms explain the relationship between CHRM1 loss and mitochondrial dysfunction in neurodegenerative disorders?

The relationship between CHRM1 and mitochondrial function involves several interdependent mechanisms:

  • Organization of respiratory complexes:

    • CHRM1 loss reduces oligomerization of ATP synthase (complex V)

    • CHRM1 deletion impairs the formation of respirasomes (supercomplexes of complexes I-IV)

    • These organizational changes directly impact electron transport efficiency

  • Mitochondrial membrane integrity:

    • CHRM1-/- mitochondria show significant ultrastructural defects, particularly cristae disruption

    • These structural changes likely affect membrane potential and proton gradient

  • Respiratory chain function:

    • Oxygen consumption rates are significantly reduced in CHRM1-/- cortical mitochondria

    • Complex I-IV-mediated respiration is particularly affected

    • State 3 (ADP-stimulated) respiration is significantly diminished

The demonstration that overexpression of CHRM1 in cells lacking the native receptor can rescue these defects provides strong evidence for a direct causal relationship between CHRM1 and mitochondrial function, rather than secondary effects .

What behavioral and cognitive effects are observed in CHRM1 knockout models?

CHRM1 knockout mice show a specific pattern of cognitive and behavioral effects:

  • No deficits in sensory-motor gating, nociception, motor coordination, or anxiety-related behavior

  • Preserved hippocampal learning and memory in standard tests

  • Severe impairment in non-matching-to-sample working memory tasks that require cortical-hippocampal coordination

This selective pattern of deficits aligns with the expression pattern of CHRM1 in cortical laminae V pyramidal neurons that facilitate cortical-subcortical communication . The specificity of the cognitive impairment in working memory without broader deficits in other domains makes CHRM1 knockout mice particularly valuable for studying aspects of cognitive dysfunction relevant to schizophrenia and Alzheimer's disease .

How can mitochondrial fractions enriched for CHRM1 be isolated for functional studies?

The isolation and enrichment of CHRM1-containing mitochondria requires specialized techniques:

  • Preparation of enriched mitochondrial fractions:

    • Isolation protocols should yield both intact isolated mitochondria and membrane-bound mitochondria present in excitatory presynaptic dendritic terminals

    • Verification of mitochondrial enrichment using markers like Voltage Dependent Anion Channel (Vdac1)

    • Quantification shows 2-3 fold enrichment of both mitochondrial markers and CHRM1 in these fractions

  • Characterization and quality control:

    • Transmission electron microscopy (TEM) to verify the structural integrity of isolated mitochondria

    • Identification of synaptic terminals by the presence of synaptic vesicles adjacent to synaptic clefts

    • The fraction should contain both presynaptic terminals (identified by abundant synaptic vesicles) and postsynaptic terminals (less electron-dense with fewer vesicles)

This approach enables the study of CHRM1 in its native mitochondrial environment, allowing for functional assays that would not be possible with recombinant systems alone .

What assays are most effective for measuring CHRM1-mediated mitochondrial function?

Several complementary assays can effectively measure the impact of CHRM1 on mitochondrial function:

  • Oxygen consumption rate (OCR) measurements:

    • Coupling assays to evaluate respiration states (basal, state 3, state 4, and maximal)

    • Electron flow assays to assess function of specific respiratory chain complexes

    • Measurement in point-to-point mode to capture dynamic changes and middle-point mode for statistical comparisons

  • Analysis of respiratory chain complex assembly:

    • Blue native polyacrylamide gel electrophoresis to separate intact respiratory complexes and supercomplexes

    • Immunoblotting with antibodies specific to different complex subunits (Ndufb8, Sdhb, Uqcrc2, Mtco1, Atp5a)

    • Quantification of high molecular weight (≥720 kDa) complexes and subcomplexes (100-500 kDa)

  • Respiratory parameters calculation:

    • Respiratory Control Ratio (RCR) = State 3 respiration / State 4 respiration

    • Non-mitochondrial respiration subtraction to calculate true mitochondrial oxygen consumption

These methods have successfully demonstrated significant functional deficits in cortical mitochondria from CHRM1 knockout mice and shown that CHRM1 overexpression can rescue these defects .

How can recombinant CHRM1 be effectively tagged for localization studies?

Effective fluorescent tagging of CHRM1 requires careful design to maintain receptor functionality:

  • N-terminal GFP tagging has been successfully used for visualizing CHRM1 localization and trafficking

  • This approach preserves the receptor's ability to colocalize and comigrate with mitochondria in neurons

  • For mitochondrial colocalization studies, combining GFP-tagged CHRM1 with mitochondrial localization signal peptide-tagged RFP provides effective dual visualization

  • Time-lapse confocal imaging of these tagged constructs enables tracking of dynamic interactions between CHRM1 and mitochondria in living neurons

While the search results don't specifically address potential functional impairments from tagging, the successful localization studies suggest that N-terminal fluorescent protein tagging preserves at least some aspects of CHRM1 function and trafficking .

What methods are optimal for studying CHRM1 signaling in ex vivo preparations?

The [³⁵S]-GTP-γ-S-Gαq/11 immunocapture method has proven effective for studying CHRM1 signaling in human tissue:

  • Assay preparation:

    • Membrane preparation from post-mortem human cortical tissue (specifically Brodmann area 9)

    • Treatment with CHRM agonists (oxotremorine-M) or CHRM1-selective agonists (AC-42)

    • Measurement of G-protein activation through [³⁵S]-GTP-γ-S binding to Gαq/11

  • Data analysis approach:

    • Concentration-response curves fitted by non-linear regression analysis with variable slope

    • Assessment of key parameters:

      • Signal window (counts per minute)

      • Hill slope (measure of cooperativity)

      • pEC₅₀ (measure of potency)

    • Analysis of covariance with age as a covariate for binding-over-basal measurements

    • Pearson product-moment correlations to analyze relationships between experimental and clinical parameters

This method has successfully identified altered signaling properties in schizophrenia patients, demonstrating increased efficacy of CHRM1-Gαq/11 coupling despite reduced receptor expression .

How might CHRM1-targeting approaches differ between Alzheimer's disease and schizophrenia?

Based on current understanding, therapeutic strategies targeting CHRM1 would need distinct approaches for each condition:

For Alzheimer's disease:

  • Focus on preserving or increasing CHRM1 expression levels, which are reduced in AD cortices

  • Target mitochondrial function, given the established connection between CHRM1 loss and mitochondrial dysfunction

  • Consider approaches that could stabilize the interaction between CHRM1 and mitochondria to maintain energy production

For schizophrenia (particularly MRDS):

  • Address the paradoxical increase in CHRM1-G protein coupling efficiency despite reduced receptor numbers

  • Consider compounds that might normalize this compensatory mechanism rather than simply increasing receptor expression

  • Target downstream signaling pathways that may be dysregulated due to altered coupling efficiency

Both conditions would benefit from approaches that consider CHRM1's role in gene expression regulation, as CHRM1-mediated changes in gene expression are relevant to both pathologies .

What are the current challenges in developing CHRM1-targeted therapeutics?

Several challenges need to be addressed in CHRM1-targeted therapeutic development:

  • Heterogeneity in receptor dysfunction:

    • Subpopulation-specific alterations (e.g., MRDS in schizophrenia)

    • Variable expression changes across brain regions

    • Potential differences in peripheral versus central nervous system effects

  • Technical challenges:

    • Species differences in antibody reactivity and post-translational modifications

    • Difficulty in reliably measuring receptor function in patient tissues

    • Need for methods that can distinguish CHRM1 from other muscarinic receptor subtypes

  • Complex functional considerations:

    • Dual role in traditional G-protein signaling and mitochondrial function

    • Adaptive changes in signaling efficiency that may counteract therapeutic approaches

    • Potential off-target effects on mitochondrial function in non-neuronal tissues

Addressing these challenges requires continued research into CHRM1 biology and development of increasingly specific tools to target this receptor and its downstream pathways .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.