Recombinant Human Myelin and lymphocyte protein (MAL)

Shipped with Ice Packs
In Stock

Description

Functional Roles in Cellular Processes

Recombinant MAL is used to study the following biological mechanisms:

Lipid Raft Stabilization and Protein Sorting

  • Facilitates apical transport of proteins in polarized epithelial cells .

  • Essential for partitioning Src-family kinases (e.g., Lck) into detergent-resistant membranes (DRMs) in T-cells .

T-Cell Signaling and Immunological Synapse Formation

  • Mediates Lck transport to the plasma membrane via MAL-containing vesicles .

  • Required for polarization of the T-cell receptor (TCR) and microtubule-organizing center during immunological synapse assembly .

Myelin Biogenesis

  • Promotes sorting of proteolipid protein (PLP) and neurofascin 155 in oligodendrocytes .

  • MAL knockout mice show paranodal structural defects in myelin .

Research Applications and Findings

Recombinant MAL has been pivotal in elucidating its dual role in cancer and immune regulation:

Oncogenic vs. Tumor-Suppressive Roles

ContextMAL ExpressionFunctional OutcomeSource
Lymphomas (PMBL, ATL)OverexpressedPromotes cell proliferation via Lck/Ras-MAPK pathway .
Ovarian/Endometrial CancerOverexpressedCorrelates with advanced stage, poor survival .
Gastrointestinal CancersHypermethylatedDownregulation linked to tumor suppression .

Immune Microenvironment Modulation

  • High MAL expression correlates with CD4+ memory T-cell infiltration in uterine corpus endometrial carcinoma (UCEC) .

  • Upregulates immune checkpoints (e.g., PD-L1, LAG3) in UCEC .

Experimental Use of Recombinant MAL

  • Mechanistic Studies: Used to restore Lck transport in MAL-deficient T-cells, rescuing TCR signaling defects .

  • Drug Resistance: Overexpression in ovarian cancer cells enhances chemoresistance, likely via lipid raft-mediated pathways .

  • Gene Silencing: siRNA-mediated MAL knockdown reduces Lck plasma membrane localization, impairing T-cell activation .

Clinical and Therapeutic Implications

  • Biomarker Potential: MAL expression stratifies UCEC patients into high- and low-risk groups (AUC = 0.635 for 5-year survival) .

  • Targeted Therapy: Inhibition of MAL-Lck interaction could disrupt oncogenic signaling in lymphomas .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
MAL; Myelin and lymphocyte protein; T-lymphocyte maturation-associated protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-153
Protein Length
Full length protein
Species
Homo sapiens (Human)
Target Names
MAL
Target Protein Sequence
MAPAAATGGSTLPSGFSVFTTLPDLLFIFEFIFGGLVWILVASSLVPWPLVQGWVMFVSV FCFVATTTLIILYIIGAHGGETSWVTLDAAYHCTAALFYLSASVLEALATITMQDGFTYR HYHENIAAVVFSYIATLLYVVHAVFSLIRWKSS
Uniprot No.

Target Background

Function
Plays a crucial role in vesicular trafficking between the Golgi complex and the apical plasma membrane. May also be involved in myelin biogenesis and/or function.
Gene References Into Functions

Published Research Highlights: The following studies highlight the significance of Myelin and lymphocyte protein (MAL) in various biological processes and disease states:

  1. Overexpression in platinum-resistant high-grade serous ovarian carcinoma patients, serving as an independent prognostic survival marker. (PMID: 28545541)
  2. Methylation and downregulation observed in human gastric cancer. (PMID: 27329150)
  3. Significantly higher expression in Merkel cell polyomavirus-negative compared to positive Merkel cell carcinomas. (PMID: 26772392)
  4. CADM1/MAL methylation increases with cervical intraepithelial neoplasia severity. (PMID: 26219541)
  5. Hypermethylation associated with reduced gene expression and colorectal cancer formation. (PMID: 26482433)
  6. Confers Clostridium perfringens epsilon-toxin binding and susceptibility, with rat MAL showing significantly higher sensitivity than human MAL. (PMID: 25993478)
  7. Potential biomarker for full molecular screening in HIV-positive, human papillomavirus-positive women. (PMID: 26473640)
  8. Critical role in exosome secretion in human T cells, suggesting potential for modulating exosome secretion. (PMID: 26109641)
  9. MAL hypermethylation linked to esophageal carcinoma progression. (PMID: 24088706)
  10. Complementary to cytology in detecting CIN2+/CIN3+ in HPV-positive women. (PMID: 25667975)
  11. DNA methylation analysis of CADM1, MAL, and miR124-2 consistently detects cervical cancer. (PMID: 25281766)
  12. Gene repression associated with lymph node metastasis and poor prognosis in gastric cancer, suggesting a potential metastasis-suppressor role. (PMID: 24511665)
  13. CADM1 and MAL methylation levels correlate with lesion severity. (PMID: 23456988)
  14. Hypomethylation of LINE-1 and hypermethylation of SLIT2, MAL, and IGFBP7 frequently detected in NSCLCs and associated with clinical features. (PMID: 23381221)
  15. Significant decrease in MAL gene expression in oral squamous cell carcinoma compared to normal epithelium. (PMID: 23224601)
  16. DNA methylation status of CADM1, MAL, and hsa-miR-124-2 analyzed in hrHPV-positive cervical scrapes. (PMID: 23176198)
  17. CADM1-M18 and MAL-M1 methylation may serve as an alternative molecular triage tool for hrHPV-positive women. (PMID: 21190187)
  18. Combination of CADM1 and MAL methylation as a promising triage tool for hrHPV-positive women. (PMID: 21389098)
  19. Expression changes in laryngeal epithelial cells during early carcinoma development. (PMID: 19670627)
  20. Roles for tyrosines 86 and 106 in signaling pathways involving MAL. (PMID: 20822478)
  21. Epigenetic inactivation contributing to human epithelial cell carcinoma, potentially serving as an HNSCC biomarker. (PMID: 21092172)
  22. Caspase-1 cleavage site in Mal as part of a TIR-domain interaction site. (PMID: 20048342)
  23. Higher MAL transcript levels in resistant ovarian cell lines. (PMID: 19642140)
  24. Considered a potential tumor suppressor gene in esophageal squamous cell carcinoma. (PMID: 15188492)
  25. Presence of Caveolin-1 and MAL on prostasomes secreted by prostate cancer cells. (PMID: 15466889)
  26. MAL protein modifies the plasma membrane, increasing resistance to detergent-induced pore formation. (PMID: 16785208)
  27. Loss of MAL expression associated with precancerous esophageal lesions. (PMID: 17151798)
  28. Promoter hypermethylation present in colorectal adenomas and carcinomas, rarely in normal mucosa. (PMID: 17408629)
  29. Promoter hypermethylation in the vast majority of benign and malignant colorectal tumors, rarely in normal mucosa. (PMID: 18346269)
  30. Putative tumor suppressor gene function in gastric cancer; promoter hypermethylation as a potential prognostic marker. (PMID: 19002170)
  31. MAL gene inactivation in breast cancer predicting benefit from adjuvant chemotherapy. (PMID: 19208741)
  32. Suggests MAL gene as a new metastasis-suppressor candidate for head and neck cancer. (PMID: 19445022)
Database Links

HGNC: 6817

OMIM: 188860

KEGG: hsa:4118

STRING: 9606.ENSP00000310880

UniGene: Hs.80395

Protein Families
MAL family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is the basic structure of human MAL protein?

Human MAL is a small proteolipid (approximately 17 kDa) belonging to the MARVEL domain-containing protein family. The MARVEL (MAL and Related proteins for VEsicle trafficking and membrane Link) domain is highly conserved across species and present in nearly 20 open reading frames in the human genome. The architecture of this domain is M-shaped, consisting of 4 helical transmembrane segments spanning the membrane bilayer . The C-terminus of MAL is notably short (only 7 amino acids) but includes critical motifs required for endoplasmic reticulum retrieval and endocytosis, particularly the tetra-peptide Leu-Ile-Arg-Trp which plays a crucial role in targeting MAL to membrane rafts . Structural studies comparing MAL to other MARVEL proteins such as synaptophysin I suggest MAL may form hexameric basket-like complexes resembling gap junction channels .

What are the primary biological functions of MAL?

MAL functions primarily in the assembly and stabilization of membrane rafts (MR) and in protein targeting. Specifically, MAL:

  • Facilitates apical sorting and transport of proteins in polarized epithelial cells, including influenza virus hemagglutinin

  • Mediates trafficking and sorting of neurofascin 155, Caspr, and potassium channel Kv 1.2 in oligodendrocytes, essential for proper paranodal-axon structure

  • Enables sorting and transport of Src-like tyrosine kinase (Lck) in T-lymphocytes, with critical implications for T cell receptor-mediated signaling

  • Interacts with glycosphingolipids to form microdomains in myelin-forming cells and epithelial cells

  • Regulates exosome trafficking and secretion in T-cells, affecting processes like HIV-Nef protein interaction and exosome release

These diverse functions position MAL as a critical component in cellular membrane organization and signaling pathways.

How does recombinant human MAL differ from native MAL protein?

Recombinant human MAL, produced through molecular cloning and heterologous expression systems, maintains the amino acid sequence of native MAL but may exhibit differences in post-translational modifications depending on the expression system used. While the primary sequence remains identical, differences may include:

  • Glycosylation patterns, which can vary between expression systems (mammalian, insect, yeast, bacterial)

  • The presence of fusion tags (His, GST, etc.) for purification purposes, which may alter protein behavior if not removed

  • Potential differences in lipid interactions due to the reconstitution environment after purification

  • Possible variations in oligomeric state stability depending on purification and storage conditions

For optimal research applications, expression in mammalian systems is often preferred to maintain native-like post-translational modifications, though this should be evaluated experimentally for each specific application .

What are the most effective systems for recombinant human MAL expression?

For membrane proteins like MAL, expression system selection significantly impacts protein yield, folding, and functionality. Based on current methodological approaches for similar membrane proteins:

  • Mammalian expression systems (HEK293, CHO cells): Provide native-like post-translational modifications and proper membrane insertion, making them ideal for functional studies. Lentiviral transduction can establish stable cell lines for consistent production.

  • Insect cell systems (Sf9, High Five): Offer good compromise between yield and proper folding, particularly useful for structural studies requiring higher protein quantities.

  • Cell-free expression systems: Enable direct incorporation into nanodiscs or liposomes, potentially preserving native-like lipid interactions critical for MAL function.

For maximum functional integrity, co-expression with lipids or reconstitution into lipid environments containing glycosphingolipids may be necessary, as MAL interacts critically with these components to form functional microdomains .

What purification strategies overcome the challenges associated with recombinant MAL isolation?

Purifying recombinant MAL presents challenges due to its hydrophobic nature and intimate association with lipid rafts. Effective purification strategies include:

  • Detergent screening and optimization: Testing multiple detergents (DDM, LMNG, digitonin) is essential as MAL requires maintenance of its lipid associations. Gentle detergents that preserve lipid-protein interactions generally yield better functional outcomes.

  • Two-step affinity chromatography: Utilizing a combination of affinity tags (His-tag followed by FLAG-tag purification, for example) improves purity while minimizing harsh elution conditions.

  • Size exclusion chromatography: Critical for separating properly folded MAL from aggregates and determining oligomeric state, which impacts functional studies.

  • Reconstitution into nanodiscs or liposomes: Post-purification incorporation into lipid environments helps maintain function, particularly for interaction studies with binding partners like Lck in T cells.

For studying MAL-Lck interactions specifically, co-purification approaches may be valuable to capture and analyze the protein complexes as they exist in their native environment .

How can recombinant MAL be used to investigate its dual role in cancer?

MAL exhibits contrasting roles in cancer progression, functioning as both tumor promoter and suppressor depending on context. Recombinant MAL can be utilized to investigate this duality through:

  • Protein-protein interaction studies: Using purified recombinant MAL in pull-down assays or surface plasmon resonance to identify differential binding partners in various cancer contexts. This approach has revealed that MAL can interact with signaling intermediaries including non-receptor tyrosine kinases (Src, Lck, Fyn), cellular receptors (TCR), cytoplasmic tyrosine kinases (ZAP-70), phospholipases (PLC-γ), and small GTPases .

  • Reconstituted membrane systems: Creating artificial membrane systems with defined lipid composition allows for controlled studies of how MAL organizes membrane domains differently in tumor-promoting versus tumor-suppressing contexts.

  • Cell-based reporter assays: Introducing recombinant MAL into MAL-null cancer cell lines while monitoring activation of RAF-mediated apoptosis pathways versus MEK-ERK and PIk3-Akt proliferative pathways can elucidate the conditions that determine its opposing functions .

  • Domain swap and mutation analysis: Systematic mutation of MAL domains can identify specific regions responsible for tumor suppression versus promotion, particularly focusing on the C-terminal motifs that target MAL to membrane rafts.

These approaches can help resolve the current contradiction regarding MAL's role in cancer and potentially identify cancer-specific therapeutic targets.

What methods effectively assess MAL's role in T cell signaling pathways?

To investigate MAL's critical function in T cell signaling, particularly its role in Lck targeting and immunological synapse formation, researchers can employ:

  • Live-cell imaging with fluorescently tagged recombinant MAL: Visualizing MAL-containing transport carriers in real-time during T cell activation using techniques like total internal reflection fluorescence (TIRF) microscopy. This approach has revealed that MAL travels to the plasma membrane in specific transport carriers containing Lck .

  • Reconstitution experiments in MAL-knockdown cells: Expressing recombinant wild-type or mutant MAL in siRNA-suppressed backgrounds to assess rescue of Lck targeting, TCR polarization, and IL-2 transcription activation. Complete correction of defects requires exogenous expression of functional MAL .

  • Detergent-resistant membrane fractionation: Quantifying how recombinant MAL affects partitioning of signaling molecules into detergent-insoluble membranes before and after T cell activation, as MAL is required for partitioning of Lck into these specialized membrane domains .

  • Proximity labeling approaches: Utilizing MAL fusion proteins with BioID or APEX2 tags to identify the proximal protein network in resting versus activated T cells, revealing context-specific interaction partners.

These methods collectively provide mechanistic insights into how MAL orchestrates the spatial organization of T cell signaling components.

How can researchers optimize experimental conditions for studying MAL-lipid interactions?

MAL's function is intimately connected to its lipid environment. To study these interactions effectively:

  • Lipid raft isolation optimization: Standardize detergent concentration, temperature, and gradient composition when isolating MAL-containing membrane rafts. Typical protocols use 1% Triton X-100 at 4°C, but optimization for specific cell types is essential.

  • Reconstitution lipid composition: When reconstituting purified recombinant MAL, include physiologically relevant lipids, particularly glycosphingolipids, which are crucial for MAL's function in forming microdomains in myelin-forming cells and epithelial cells .

  • Fluorescence correlation spectroscopy (FCS): Employ FCS to measure diffusion coefficients of fluorescently labeled MAL in different membrane environments, providing quantitative measures of MAL's membrane domain organization capabilities.

  • Atomic force microscopy (AFM): Use AFM to visualize and quantify MAL-induced alterations in membrane topography and mechanical properties, particularly how it stabilizes membrane domains.

A critical control experiment involves comparing wild-type MAL with mutants in the C-terminal tetra-peptide Leu-Ile-Arg-Trp, as this motif is essential for MAL's incorporation into membrane rafts. Mutations, deletions, or insertions in this region result in misdistribution of MAL and loss of function .

What are the main challenges in producing functional recombinant MAL and how can they be addressed?

Several challenges complicate the production of functional recombinant MAL:

ChallengeSolution ApproachSupporting Evidence
Protein aggregation during purificationInclusion of lipids or mild detergents (DDM, LMNG) during extraction and purificationMembrane proteins like MAL require lipid interactions for stability
Poor membrane insertion and topologyUse of mammalian expression systems with appropriate signal sequencesMAL contains 4 transmembrane segments requiring proper orientation
Loss of function due to tagsIncorporation of cleavable tags or careful placement at non-functional regionsC-terminal tagging disrupts critical targeting motifs
Low expression levelsCodon optimization and use of inducible expression systemsImproves translation efficiency and controls potential toxicity
Functional verificationDevelopment of binding assays with known partners (Lck, glycosphingolipids)MAL functions through specific protein and lipid interactions

To address these challenges holistically, researchers should consider pilot experiments with multiple constructs and expression systems, followed by thorough functional validation comparing recombinant MAL to the native protein in cellular assays.

How do researchers reconcile contradictory findings about MAL's role in different cancer types?

The contradictory roles of MAL in cancer—tumor suppressor in adenocarcinomas versus oncogenic factor in ovarian cancer and lymphomas—present a significant analytical challenge. To systematically approach this contradiction:

  • Tissue-specific context analysis: Compare MAL's interactome across different tissue types using co-immunoprecipitation with recombinant MAL followed by mass spectrometry. This may reveal tissue-specific binding partners that dictate opposing functions.

  • Signaling pathway mapping: Use phospho-proteomics to compare signaling events downstream of MAL in contexts where it promotes versus suppresses tumor growth. Current evidence suggests MAL may activate MEK-ERK and PIk3-Akt pathways in cancer-promoting contexts, similar to the Epstein-Barr virus oncoprotein LMP-1 .

  • Epigenetic regulation assessment: Analyze the methylation status of the MAL promoter alongside expression levels in various cancer types, as promoter hypermethylation appears to be a hallmark of several adenocarcinomas .

  • Isoform and mutation screening: Although no MAL mutations or isoforms have been definitively associated with these opposing functions , comprehensive sequencing across cancer types may reveal subtle variants that explain functional differences.

By integrating these approaches, researchers can develop models that explain how the same protein exhibits context-dependent functions in cancer progression.

What analytical frameworks best capture MAL's complex role in membrane organization?

To comprehensively analyze MAL's multifaceted roles in membrane organization:

  • Quantitative protein-lipid interaction mapping: Employ lipidomics coupled with protein interaction analysis to quantify how MAL selectively enriches specific lipids and proteins in membrane domains. This requires careful isolation of MAL-containing membrane fractions followed by mass spectrometry.

  • Super-resolution microscopy data analysis: Analyze nanoscale distribution patterns of MAL using STORM or PALM microscopy, applying spatial statistics to quantify clustering behaviors before and after cell activation signals.

  • Computational modeling: Develop membrane simulations incorporating MAL's known properties to predict how it affects membrane curvature, thickness, and molecular diffusion rates.

  • Comparative analysis across cell types: Create standardized analytical frameworks to compare MAL's effects in different cellular contexts (epithelial cells, T cells, oligodendrocytes), identifying common principles versus context-specific functions.

These analytical approaches should be integrated to develop a comprehensive model of how MAL organizes functional membrane domains across diverse cellular contexts, particularly focusing on its critical roles in apical sorting, T cell receptor signaling, and exosome trafficking .

What are promising research avenues for therapeutic applications targeting MAL?

Several therapeutic approaches leveraging MAL biology show promise for future development:

  • Cancer diagnostics and therapies: The differential expression of MAL across cancer types presents opportunities for both diagnostic markers and targeted therapies. For adenocarcinomas showing MAL promoter hypermethylation, epigenetic modifiers that restore MAL expression could potentially reactivate tumor suppression pathways .

  • T cell immunotherapy enhancement: Given MAL's critical role in T cell signaling and immunological synapse formation , engineered T cells with optimized MAL expression or function could potentially improve CAR-T cell therapies by enhancing signaling efficiency and target recognition.

  • Autoimmune disease intervention: Targeting the MAL-dependent pathway for Lck targeting could modulate T cell activation thresholds, potentially providing new approaches for autoimmune disease treatment without global immunosuppression.

  • Myelin disorders: As MAL is involved in myelin formation and maintenance, recombinant MAL-based approaches might help address demyelinating conditions by supporting remyelination processes.

Research designs should include in vivo models to evaluate the systemic effects of these interventions, particularly focusing on potential off-target effects given MAL's diverse functions across tissue types.

How might emerging technologies advance our understanding of MAL biology?

Cutting-edge technologies that could significantly advance MAL research include:

  • Cryo-electron microscopy: Determining the high-resolution structure of MAL alone and in complex with its binding partners would provide unprecedented insights into its mechanism of action, particularly how it forms hexameric basket-like complexes resembling gap junction channels .

  • Single-molecule tracking in living cells: Following the behavior of individual MAL molecules during membrane trafficking and signaling events would reveal dynamic aspects of its function not captured by ensemble measurements.

  • CRISPR-based screening: Genome-wide CRISPR screens in the context of MAL function could identify novel regulators and effectors of MAL-dependent pathways across different cell types.

  • Organoid systems: Studying MAL in three-dimensional organoid cultures would better capture its role in complex tissues with polarized epithelial structures, potentially revealing functions not evident in traditional cell culture.

These approaches would help resolve current contradictions in MAL biology, particularly regarding its opposing roles in cancer and the mechanisms underlying its diverse functions across cell types.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.