Recombinant Human Myelin protein zero-like protein 3 (MPZL3)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Our standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline for your preparation.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
MPZL3; UNQ2966/PRO7425; Myelin protein zero-like protein 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
32-235
Protein Length
Full Length of Mature Protein
Species
Homo sapiens (Human)
Target Names
MPZL3
Target Protein Sequence
LEIRADAHVRGYVGEKIKLKCTFKSTSDVTDKLTIDWTYRPPSSSHTVSIFHYQSFQYPT TAGTFRDRISWVGNVYKGDASISISNPTIKDNGTFSCAVKNPPDVHHNIPMTELTVTERG FGTMLSSVALLSILVFVPSAVVVALLLVRMGRKAAGLKKRSRSGYKKSSIEVSDDTDQEE EEACMARLCVRCAECLDSDYEETY
Uniprot No.

Target Background

Function
Mediates homophilic cell-cell adhesion.
Gene References Into Functions
  1. Homozygous or compound heterozygous mutations in MPZL3 may be implicated in immune-mediated human hereditary disorders involving hair loss. PMID: 19054061
Database Links

HGNC: 27279

OMIM: 611707

KEGG: hsa:196264

STRING: 9606.ENSP00000278949

UniGene: Hs.15396

Protein Families
Myelin P0 protein family
Subcellular Location
Membrane; Single-pass type I membrane protein.

Q&A

What is the basic structure of human MPZL3 protein?

MPZL3 is a 235 amino acid protein characterized by two transmembrane motifs at amino acid positions 12-34 and 159-181 that flank an extracellular immunoglobulin-like (Ig-like) V-type domain positioned between amino acids 31-148 . The protein contains a recognition loop within the Ig-like domain that plays crucial roles in cell-cell recognition and adhesion mechanisms. Structural modeling indicates that MPZL3 shares significant homology with myelin protein zero (MPZ) and myelin protein zero-like 2 (MPZL2, also called epithelial V-like antigen) . The protein's structure suggests it functions as a cell membrane-anchored adhesion molecule, with its Ig domain extending into the extracellular space to mediate interactions with other cells or matrix components.

How is MPZL3 gene organized and what are its key identifiers?

The human MPZL3 gene is located on chromosome 11q23.3 and displays high homology to the mouse Mpzl3 gene in terms of genomic context, exon/intron organization, and nucleotide sequence . The murine Mpzl3 gene consists of six exons spanning over 19 kb on mouse Chromosome 9 (44.989–45.010 Mb) . In humans, the gene has several key identifiers including HGNC: 27279, NCBI Gene: 196264, Ensembl: ENSG00000160588, OMIM: 611707, and UniProtKB/Swiss-Prot: Q6UWV2 . Alternative splicing of the Mpzl3 gene has been observed, with evidence for at least two transcripts in mice – one encoding a polypeptide of 96 amino acids and another encoding a protein of 237 amino acids .

What is known about MPZL3 evolutionary conservation?

MPZL3 shows remarkable evolutionary conservation, particularly among mammals. Analysis from the Ensembl database identified orthologues of MPZL3 protein in mammals with 89–96% similarity, with conservation declining in non-mammalian vertebrates . Of particular significance is the conservation of specific residues within the Ig V-type domain, including the Arginine at position 100 (R100) which is conserved across all vertebrate species examined . This high degree of conservation suggests that MPZL3 plays a fundamental role in vertebrate biology that has been maintained through evolutionary pressure.

What are the recommended approaches for detecting MPZL3 protein in different tissues?

For detecting MPZL3 protein in tissue samples, immunohistochemistry and Western blot analysis using specific antibodies have proven effective. Research has successfully used affinity-purified rabbit polyclonal antibodies against specific peptide epitopes of the MPZL3 protein. One such epitope used in mouse studies was DKLTIDWTYRPPSSSRT, located in the predicted extracellular domain . Antibody specificity should be validated through preabsorption controls with the target peptide. In immunohistochemical applications, indirect immunofluorescence can efficiently detect MPZL3 expression in tissues such as skin, with particular attention to membrane localization consistent with its role as a transmembrane protein .

For Western blot analysis, researchers should be aware that MPZL3 may appear at different molecular weights depending on post-translational modifications or different transcripts. Studies have detected bands ranging from approximately 27-29 kDa (in transfected cells) to approximately 70 kDa (in mouse organs) . Additionally, variations in band patterns between cultured cells and tissue samples have been observed, suggesting tissue-specific post-translational modifications or expression of different isoforms.

How can antisense oligonucleotides be used to investigate MPZL3 function?

Antisense oligonucleotide (ASO) technology has proven effective for acutely knocking down MPZL3 expression to study its function in vivo. Studies have demonstrated that ASO-mediated knockdown of Mpzl3 dose-dependently decreases fat mass and circulating lipids in high-energy diet-fed mice . When implementing this approach, researchers should:

  • Design ASOs targeting specific exons of the MPZL3 gene

  • Test multiple doses to establish dose-dependent effects (as demonstrated in previous research)

  • Confirm knockdown efficiency through qPCR and Western blot analysis

  • Compare phenotypes with appropriate control groups receiving non-targeting ASOs

  • Measure relevant metabolic parameters including body composition, energy expenditure, respiratory exchange ratio, and gene expression in target tissues

This method offers advantages over global knockout models by allowing investigation of acute effects in adult animals without developmental compensation and enabling tissue-specific knockdown when delivered peripherally .

What is the role of MPZL3 in cell adhesion and tissue integrity?

MPZL3 functions as a mediator of homophilic cell-cell adhesion , with its structure and functional domains suggesting involvement in critical adhesion mechanisms. The protein contains an immunoglobulin V-type domain with a recognition loop that has established roles in T-cell receptors and cell adhesion . This structural feature, combined with its predicted localization to the plasma membrane, suggests that MPZL3 participates in cell-cell interactions that are crucial for maintaining tissue integrity.

Experimental evidence supports this role, as immunofluorescence studies have detected strong MPZL3 staining around the plasma membrane of keratinocytes in the epidermis and hair follicles, consistent with its predicted function as a transmembrane protein involved in cell adhesion . Furthermore, the Human Protein Reference Database biological process prediction suggests an immune response role for MPZL3 , indicating potential involvement in immune cell adhesion and recognition processes.

How does MPZL3 contribute to metabolic regulation?

MPZL3 plays a significant role in metabolic regulation, particularly in lipid metabolism and energy homeostasis. Studies have shown that both global knockout of Mpzl3 and acute ASO-mediated knockdown result in similar metabolic phenotypes, demonstrating that these effects are direct consequences of MPZL3 inhibition rather than developmental compensations .

The metabolic effects of MPZL3 inhibition include:

  • Reduced body weight and adiposity

  • Decreased circulating lipid levels

  • Altered whole-body substrate utilization (decreased respiratory exchange ratio indicating increased fat oxidation)

  • Tissue-specific changes in metabolic gene expression:

    • Decreased expression of de novo lipogenesis genes in white adipose tissue

    • Upregulation of genes associated with steroid hormone biosynthesis in liver

    • Enhanced expression of thermogenesis genes in brown adipose tissue

    • Increased fatty acid transport gene expression in skeletal muscle

These findings suggest that MPZL3 functions as a regulator of energy metabolism, potentially through integrating signals across multiple tissues. The ability of acute MPZL3 inhibition to prevent diet-induced obesity and associated metabolic disturbances positions it as a potential therapeutic target for metabolic disorders.

What is the relationship between MPZL3 and skin physiology?

MPZL3 appears to play a critical role in skin physiology and hair follicle cycling. The identification of an Mpzl3 mutation (R100Q) in rough coat (rc) mice, which develop severe skin and hair abnormalities, provides strong evidence for this relationship . These mice exhibit cyclic and progressive hair loss, sebocyte hyperplasia, and sebaceous gland hypertrophy . Additionally, by one year of age, many rc mice develop spontaneous ulcerated lesions on the ventral skin of the neck with extensive granulation tissue formation and inflammatory dermatitis .

Immunohistochemical analysis has detected MPZL3 protein expression in keratinocytes of the epidermis and hair follicles, as well as in sebocytes . This expression pattern aligns with the phenotypes observed in rc mice, suggesting that MPZL3 contributes to the regulation of keratinocyte differentiation, sebaceous gland function, and hair follicle cycling. The specific R100Q mutation identified in rc mice occurs within the conserved Ig-like V-type domain, likely altering the protein's function in mediating cell-cell interactions essential for normal skin development and homeostasis .

What human diseases are associated with MPZL3 dysfunction?

Based on available research, MPZL3 has been associated with several human conditions. According to the GeneCards database, diseases associated with MPZL3 include Linear Skin Defects With Multiple Congenital Anomalies 2 and Seborrheic Dermatitis . These associations are consistent with the skin and hair phenotypes observed in mouse models with Mpzl3 mutations.

The homology between MPZL3 and immune-related proteins, along with its predicted role in immune response, suggests potential involvement in immune-mediated disorders. Research indicates that homozygous or compound heterozygous mutations of MPZL3 might be involved in immune-mediated human hereditary disorders with hair loss . The presence of inflammatory components in the skin lesions of rc mice, including neutrophilic, mastocytic, and lymphoplasmacytic dermatitis, further supports a potential link between MPZL3 dysfunction and inflammatory skin conditions .

How might targeting MPZL3 provide therapeutic benefits for metabolic disorders?

Research suggests that inhibiting MPZL3 could represent a novel therapeutic approach for treating obesity and associated metabolic disturbances. Studies using antisense oligonucleotide-mediated knockdown of Mpzl3 have demonstrated that acute reduction of MPZL3 levels can prevent the negative metabolic effects associated with consumption of a high-fat and sucrose diet .

The potential therapeutic benefits of MPZL3 inhibition include:

  • Prevention of diet-induced weight gain and adiposity

  • Improvement in glucose tolerance

  • Reduction in hyperlipidemia

  • Enhancement of whole-body fat oxidation

  • Favorable changes in tissue-specific gene expression related to lipid metabolism

These effects occur without the development of the skin phenotype observed in global knockout models, suggesting that targeted peripheral inhibition of MPZL3 could provide metabolic benefits while minimizing adverse effects . The fact that these improvements were observed with acute knockdown in adult animals indicates that they represent direct effects of MPZL3 inhibition rather than compensatory developmental changes, further supporting the potential of MPZL3 as a therapeutic target.

What are the critical factors to consider when designing experiments with recombinant MPZL3?

When working with recombinant MPZL3, researchers should consider several critical factors to ensure experimental success:

  • Protein domains and structure: The recombinant protein should maintain the critical domains of native MPZL3, particularly the Ig-like V-type domain (positions 31-148) that mediates cell-cell interactions . Consider whether to include or exclude the transmembrane domains depending on experimental goals.

  • Post-translational modifications: Evidence suggests MPZL3 undergoes significant post-translational modifications that may affect its function. Western blot analyses have detected MPZL3 at various molecular weights (27-29 kDa in transfected cells vs. ~70 kDa in tissue samples), suggesting glycosylation or dimerization . Expression systems should be selected that can reproduce relevant modifications.

  • Expression systems: Consider using mammalian expression systems for studies requiring proper folding and post-translational modifications. For structural studies or applications requiring higher yields, bacterial or insect cell systems may be appropriate with optimization.

  • Antibody selection: When detecting recombinant MPZL3, antibody specificity is crucial. Previous research successfully used antibodies against specific peptide epitopes (e.g., DKLTIDWTYRPPSSSRT) with validation through preabsorption controls .

  • Functional validation: Confirm that recombinant MPZL3 retains functional properties by assessing its ability to mediate homophilic cell-cell adhesion, which is a primary function of the native protein .

How should researchers address conflicting data regarding MPZL3's molecular weight and isoforms?

Research has revealed discrepancies in MPZL3's observed molecular weight across different experimental systems. In transfected NIH/3T3 cells, MPZL3 appears as 27 and 29 kDa bands, while in adult mouse organs, a single band at approximately 70 kDa is detected . Additional bands at ~80 and ~110 kDa have been observed in some cell systems but not in tissue samples .

To address these discrepancies, researchers should:

  • Characterize tissue-specific expression patterns: Systematically compare MPZL3 expression across multiple tissues and cell types using standardized extraction and detection methods.

  • Investigate post-translational modifications: Employ enzymatic treatments (e.g., PNGase F for N-glycosylation) to determine the contribution of various modifications to the observed molecular weight differences.

  • Analyze alternative splicing: Use RT-PCR with isoform-specific primers to identify tissue-specific expression of alternative transcripts. EST analysis has provided evidence for at least two transcripts through alternative splicing in mice .

  • Use multiple antibodies: Employ antibodies targeting different epitopes to distinguish between isoforms and confirm specificity through appropriate controls, including preabsorption with target peptides.

  • Consider protein-protein interactions: Investigate whether higher molecular weight bands represent stable complexes with other proteins by using cross-linking approaches and mass spectrometry analysis.

By systematically addressing these factors, researchers can resolve conflicting data and develop a more comprehensive understanding of MPZL3's molecular characteristics across different biological contexts.

What are the most promising avenues for exploring MPZL3's role in intercellular signaling networks?

Given MPZL3's predicted function in cell adhesion and its involvement in multiple physiological processes, investigating its role in intercellular signaling represents a promising research direction. Future studies should focus on:

  • Identifying binding partners: Employ techniques such as co-immunoprecipitation, proximity labeling, or yeast two-hybrid screening to identify proteins that interact with MPZL3, focusing on both extracellular partners that engage with its Ig-like domain and intracellular signaling molecules.

  • Characterizing signaling pathways: Investigate whether MPZL3 activates specific signaling cascades upon homophilic binding or engagement with other molecules. Phosphoproteomic analysis following MPZL3 activation or inhibition could reveal downstream signaling events.

  • Exploring tissue-specific signaling networks: Given MPZL3's involvement in both skin physiology and metabolic regulation, compare signaling networks activated by MPZL3 in different tissues to understand how it contributes to diverse biological processes.

  • Examining cross-talk with known pathways: Investigate potential interactions between MPZL3 signaling and established pathways involved in metabolism, cell adhesion, and inflammation to place MPZL3 within the broader cellular signaling landscape.

How can researchers develop improved models for studying the physiological roles of MPZL3?

To advance understanding of MPZL3 function, developing refined experimental models is essential. Researchers should consider:

  • Tissue-specific conditional knockout models: Generate mice with tissue-specific deletion of Mpzl3 to distinguish between its roles in different tissues and avoid the confounding effects of the skin phenotype observed in global knockouts.

  • Inducible expression systems: Develop models where MPZL3 expression can be temporally controlled to study its acute versus chronic effects and to distinguish between developmental and adult functions.

  • Point mutation models: Create knockin models harboring specific mutations, such as the R100Q mutation found in rc mice , to study the effects of discrete structural alterations on MPZL3 function.

  • Human cell-based models: Establish MPZL3-deficient or modified human cell lines using CRISPR-Cas9 technology to complement animal studies and explore human-specific aspects of MPZL3 biology.

  • Advanced tissue culture systems: Utilize organoid cultures or tissue-on-chip approaches to study MPZL3 function in more physiologically relevant contexts that maintain the complex cellular interactions present in vivo.

By developing these improved models, researchers can gain deeper insights into MPZL3's physiological roles and potential as a therapeutic target for various conditions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.