Recombinant Human Myeloid-associated differentiation marker-like protein 2 (MYADML2)

Shipped with Ice Packs
In Stock

Description

Introduction to MYADML2

MYADML2 (Myeloid-Associated Differentiation Marker-Like Protein 2) is a member of the MAL family of integral membrane proteins, characterized by MARVEL domains and roles in specialized membrane trafficking and signaling. Recombinant MYADML2 is produced for research purposes, often tagged with affinity markers (e.g., Strep, His) to enable purification and functional studies .

Key Production Details:

  • Cell-Free Synthesis (CFPS): Used in tobacco lysates to produce MYADML2 (AA 1–307) with Strep Tag, enabling one-step purification .

  • Protein Stability: Avoid repeated freeze-thaw cycles; store at -80°C in PBS/glycerol buffers .

Functional and Research Applications

Recombinant MYADML2 is utilized in diverse experimental contexts to study its roles in membrane biology and disease.

Membrane Trafficking and Signaling

  • Raft Organization: MYADML2 and MYADM partition into detergent-resistant membranes (DRMs), regulating membrane-cytoskeleton interactions and Rac1 targeting .

  • Cancer Progression: Overexpression in hepatocellular carcinoma (HCC) promotes proliferation and invasion, while knockdown reduces chemoresistance .

Disease Association

Disease/ConditionRole of MYADML2References
CancerElevated in HCC, metastatic melanoma, and prostate cancer; linked to drug resistance
Asthma/RhinovirusUpregulated in airway epithelial cells during RV-1B infection, correlating with inflammation
Developmental DefectsHomozygous deletion linked to cranial asymmetry and reduced bone maturation in humans

Research Gaps and Future Directions

  • Functional Mechanisms: Limited data on MYADML2’s exact role in membrane trafficking vs. cancer progression.

  • Therapeutic Potential: Exploring MYADML2 inhibitors to target chemoresistant cancers or inflammatory diseases.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. If you have a specific format requirement, please indicate it in your order notes, and we will prepare accordingly.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery times.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance. Additional fees may apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and protein stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
MYADML2; Myeloid-associated differentiation marker-like protein 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-307
Protein Length
Full length protein
Species
Homo sapiens (Human)
Target Names
MYADML2
Target Protein Sequence
MGSTMEPPGGAYLHLGAVTSPVGTARVLQLAFGCTTFSLVAHRGGFAGVQGTFCMAAWGF CFAVSALVVACEFTRLHGCLRLSWGNFTAAFAMLATLLCATAAVLYPLYFARRECSPEPA GCAARDFRLAASVFAGLLFLAYAVEVALTRARPGQVSSYMATVSGLLKIVQAFVACIIFG ALVHDSRYGRYVATQWCVAVYSLCFLATVAVVALSVMGHTGGLGCPFDRLVVVYTFLAVL LYLSAAVIWPVFCFDPKYGEPKRPPNCARGSCPWDSQLVVAIFTYVNLLLYVVDLAYSQR IRFVPSL
Uniprot No.

Target Background

Database Links

HGNC: 34548

KEGG: hsa:255275

STRING: 9606.ENSP00000327718

UniGene: Hs.729645

Protein Families
MAL family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is MYADML2 and how does it differ structurally from other MAL family proteins?

MYADML2 (Myeloid-associated differentiation marker-like protein 2) is a member of the MAL (Myelin and Lymphocyte) family of integral membrane proteins. Unlike the founding members of the family (MAL, MAL2, MALL, and PLLP) which contain a single MARVEL domain and four transmembrane segments, MYADML2 belongs to a distinct branch alongside MYADM that contains two MARVEL domains and eight transmembrane segments .

The structural differences between MYADML2 and other MAL family members can be summarized as follows:

FeatureMYADML2MYADMMAL/MAL2/MALL/PLLP
MARVEL Domains221
Transmembrane Segments884
SizeLargerLargerSmaller
Membrane LocalizationSubapical endosomes, GolgiPlasma membrane, DRMsVaries by member

These structural differences likely contribute to the specialized functions of MYADML2 in membrane organization and trafficking.

What cellular and tissue expression patterns are documented for MYADML2?

  • Unlike MYADM, which shows ubiquitous expression across multiple human cell lines, MYADML2 appears to have a more restricted expression pattern

  • MYADML2 has been detected at the mRNA level in various tissues including liver, with elevated expression noted in hepatocellular carcinoma

  • The protein has been studied in both human tissues and in animal models such as Papio anubis (olive baboon)

For researchers studying MYADML2 expression, immunohistochemistry with validated antibodies (such as HPA048476) can be used at dilutions of 1:200-1:500 according to manufacturer protocols .

What are the primary biological functions associated with MYADML2?

Based on its structural similarity to other MAL family members and limited direct experimental evidence, MYADML2 is likely involved in:

  • Membrane organization and trafficking: Similar to other MAL family proteins, MYADML2 likely participates in organizing membrane domains and facilitating protein trafficking pathways

  • Transcytosis: MYADML2 may function in the indirect apical trafficking pathway, which transports cargo from the basolateral membrane to the apical membrane via subapical endosomes

  • Golgi-to-plasma membrane transport: Evidence suggests involvement in regulating the delivery of specific cargo proteins to the cell surface

  • Potential roles in disease processes: Several studies have examined MAL family proteins, including MYADML2, in the context of cancer progression and other pathological conditions

It should be noted that many of these functions are inferred from the broader MAL family, and specific functions of MYADML2 require further experimental validation.

What are the optimal expression systems and purification strategies for producing recombinant MYADML2?

Researchers have successfully produced recombinant MYADML2 using several expression systems, each with distinct advantages:

  • E. coli expression system:

    • Suitable for producing the N-terminal 10xHis-tagged full-length protein

    • Expression region typically includes amino acids 1-307

    • Advantages include high yield and cost-effectiveness

    • Limitations include potential issues with proper folding of this multi-pass membrane protein

  • Yeast expression system:

    • Useful for producing partial MYADML2 protein

    • Provides eukaryotic post-translational modifications

    • Typically achieves >85% purity as assessed by SDS-PAGE

    • Tag types may vary depending on the manufacturing process

For optimal purification and storage:

  • Incorporate affinity tags (His-tag is commonly used) for purification

  • For reconstitution, use deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add 5-50% glycerol as a cryoprotectant for long-term storage

  • Store at -20°C/-80°C for maximum stability

  • Avoid repeated freeze-thaw cycles; working aliquots can be stored at 4°C for up to one week

How can researchers effectively silence MYADML2 expression for functional studies?

RNA interference (RNAi) approaches have been successfully employed to knock down MYADML2 expression. Based on methodologies used for related proteins and specific MYADML2 siRNA products:

  • siRNA transfection:

    • Target-specific 19-23 nt siRNA oligo duplexes can achieve effective knockdown

    • Typical transfection protocols use lipofection reagents like Lipofectamine

    • Optimal concentrations range from 50-100 nM depending on cell type

    • Maximum knockdown typically observed 48-72 hours post-transfection

  • shRNA expression:

    • For stable knockdown, shRNA expression vectors can be used

    • Targeting the coding sequence or 3' untranslated region of MYADML2 mRNA

    • Properly designed shRNAs can achieve 85-90% reduction in expression levels

    • Specificity should be validated using rescue experiments with recombinant protein that lacks the targeted region

When designing knockdown experiments, consider the following methodological controls:

  • Use scrambled siRNA sequences as negative controls

  • Validate knockdown efficiency at both mRNA level (qRT-PCR) and protein level (Western blot)

  • For phenotype rescue experiments, use MYADML2 constructs with synonymous mutations that resist siRNA binding

What methodological approaches are recommended for studying MYADML2 membrane localization and trafficking?

Studying membrane localization and trafficking of MYADML2 requires specialized techniques due to its multi-transmembrane domain structure:

  • Fluorescent protein tagging:

    • GFP or similar tags can be fused to MYADML2 for live-cell imaging

    • C-terminal tagging is generally preferable to avoid disrupting the N-terminal signal sequence

    • Validation of proper localization should be performed by comparing to endogenous protein

  • Detergent resistance assays:

    • MAL family proteins, including MYADM, partition into detergent-resistant membranes (DRMs)

    • Cold Triton X-100 extraction followed by flotation in sucrose gradients can isolate DRMs

    • This approach determines whether MYADML2 localizes to membrane rafts similar to other family members

  • Membrane domain analysis:

    • Laurdan staining can be used to visualize membrane order and lipid packing

    • Co-localization studies with known membrane domain markers (e.g., caveolin-1) help establish MYADML2's membrane domain preference

  • Trafficking assays:

    • For studying MYADML2's role in transcytosis, polarized epithelial cells grown on Transwell filters can be used

    • Cargo proteins like polymeric immunoglobulin A receptor (pIgA-R) or CD59 serve as tracers for apical trafficking pathways

    • Live-cell imaging with pulse-chase approaches allows visualization of trafficking dynamics

What experimental evidence links MYADML2 to disease processes, and how can researchers investigate these associations?

While direct evidence for MYADML2 in disease processes is still emerging, several approaches can be used to investigate potential associations:

  • Cancer association studies:

    • Elevated MYADML2 mRNA expression has been observed in hepatocellular carcinoma

    • Tissue microarray analysis with immunohistochemistry can assess protein expression across multiple patient samples

    • Kaplan-Meier survival analysis correlating expression levels with patient outcomes provides prognostic insights

  • Functional assays in disease models:

    • Cell proliferation assays (e.g., CCK-8) following MYADML2 manipulation assess impact on cell growth

    • Migration and invasion assays (Transwell, wound healing) evaluate effects on metastatic potential

    • Drug sensitivity testing determines whether MYADML2 modulates response to chemotherapeutic agents

  • Mechanistic investigations:

    • Co-immunoprecipitation identifies protein interaction partners

    • Western blot analysis of signaling pathways (e.g., examining EMT markers like Snail and Twist) reveals downstream effects

    • Transcriptional profiling following MYADML2 knockdown or overexpression identifies regulated genes

For robust disease association studies, researchers should:

  • Use multiple cell lines representing the disease of interest

  • Validate findings in patient-derived samples

  • Employ both gain- and loss-of-function approaches

  • Consider the broader MAL family context, as functional redundancy may exist

How does MYADML2 function and expression compare to the better-characterized MYADM protein?

MYADM has been more extensively studied than MYADML2, providing comparative insights:

  • Expression patterns:

    • MYADM shows ubiquitous expression across multiple human cell lines, while MYADML2 appears more restricted

    • MYADM was initially identified in hematopoietic cells and is upregulated during myeloid differentiation

    • While MYADM is detected in diverse cell types, MYADML2 expression analysis has been less comprehensive

  • Subcellular localization:

    • MYADM localizes primarily to the plasma membrane and colocalizes with F-actin in membrane ruffles

    • MYADM partitions into detergent-resistant membranes enriched in compact membrane domains

    • MYADML2 is predicted to localize to subapical endosomes and Golgi, though direct evidence is limited

  • Functional roles:

    • MYADM regulates Rac1 targeting to ordered membranes and is required for cell spreading and migration

    • MYADM expression increases during rhinovirus infection and contributes to inflammatory responses

    • In contrast, specific functional roles for MYADML2 are less well-established

These comparisons highlight the need for direct experimental investigation of MYADML2 functions rather than relying solely on inferences from MYADM studies.

What technical challenges exist in studying MYADML2 and how can researchers address them?

Researchers face several technical challenges when studying MYADML2:

  • Membrane protein expression and purification:

    • As a protein with eight transmembrane domains, MYADML2 is difficult to express and purify in functional form

    • Solution: Use specialized expression systems (insect cells, mammalian cells) that better handle complex membrane proteins

    • Consider using detergent screening approaches to identify optimal solubilization conditions

  • Antibody specificity:

    • High sequence similarity between MAL family members can lead to cross-reactivity

    • Solution: Validate antibodies using knockout/knockdown controls

    • Target unique epitopes, particularly in the N- or C-terminal regions or unique loops

  • Functional redundancy:

    • Overlapping functions with other MAL family proteins may mask phenotypes in single-gene studies

    • Solution: Consider combinatorial knockdown approaches

    • Compare phenotypes across cell types with different expression profiles of MAL family members

  • Membrane domain visualization:

    • Traditional microscopy has resolution limitations for studying membrane domains

    • Solution: Employ super-resolution techniques (STORM, PALM, STED)

    • Use proximity ligation assays to detect protein interactions within membrane domains

What are the current contradictions or knowledge gaps in MYADML2 research that warrant investigation?

Several contradictions and knowledge gaps exist in the current understanding of MYADML2:

How might emerging technologies advance our understanding of MYADML2 function?

Several cutting-edge technologies offer promising approaches for MYADML2 research:

  • CRISPR-Cas9 genome editing:

    • Generation of MYADML2 knockout cell lines and animal models

    • Knock-in of fluorescent tags at endogenous loci for physiological expression levels

    • Base editing to introduce disease-associated mutations

  • Cryo-electron microscopy:

    • Determination of MYADML2 structure at near-atomic resolution

    • Visualization of MYADML2 in membrane environments

    • Structural basis for interactions with binding partners

  • Spatial transcriptomics and proteomics:

    • High-resolution mapping of MYADML2 expression in tissues

    • Correlation with other membrane trafficking components

    • Cell-type specific functions in complex tissues

  • Organoid and patient-derived models:

    • Functional studies in more physiologically relevant systems

    • Disease modeling with patient-specific genetic backgrounds

    • Drug screening in complex 3D environments

What potential exists for targeting MYADML2 in therapeutic applications?

Based on emerging functions of MAL family proteins, several therapeutic directions may be considered:

  • Cancer therapeutics:

    • If validated as a biomarker or driver in specific cancers, MYADML2 could be targeted therapeutically

    • Approaches might include antibody-drug conjugates targeting extracellular domains

    • Small molecules disrupting protein-protein interactions essential for MYADML2 function

  • Inflammatory disease modulation:

    • Given the role of related MYADM in inflammatory responses during rhinovirus infection, MYADML2 might similarly influence inflammation

    • Potential applications in respiratory conditions or other inflammatory disorders

  • Membrane trafficking modulation:

    • Targeting MYADML2-dependent trafficking pathways could modulate cellular processes relevant to disease

    • This approach might be particularly relevant in conditions with altered protein trafficking

  • Diagnostic applications:

    • Development of MYADML2-based biomarkers for disease detection or monitoring

    • Integration into multi-marker panels for improved sensitivity and specificity

It's important to note that these therapeutic directions remain speculative until more definitive functional data on MYADML2 is established through rigorous experimental investigation.

What is the optimal protocol for studying MYADML2 in airway epithelial cells?

Given the expression of MAL family members in respiratory tissues and the role of MYADM in rhinovirus infection, researchers may wish to study MYADML2 in airway epithelial models:

  • Cell culture system:

    • Primary human airway epithelial cells (AECs) grown at air-liquid interface (ALI)

    • Cells isolated from bronchial segments according to established protocols

    • Culture in PneumaCult EX Plus supplemented with 10 μM ROCK inhibitor until 90% confluency

    • For ALI culture, seed cells on collagen-coated Transwell inserts

  • Viral infection model:

    • For rhinovirus studies, infect cells with RV-1B at MOI of 0.1-5 for 48h

    • Include UV-irradiated virus as a replication-deficient control

    • Analyze MYADML2 expression by qRT-PCR and flow cytometry

  • Inflammatory response analysis:

    • Measure cytokine production (IL-6, IL-8, TNFα) by ELISA and qRT-PCR

    • Assess correlation between MYADML2 expression and inflammatory markers

    • Consider knockdown experiments to determine functional importance

  • TLR signaling investigation:

    • Stimulate cells with poly I:C as a viral mimic

    • Analyze TLR3 pathway activation in relation to MYADML2 expression

    • Perform siRNA knockdown to assess requirement for MYADML2 in TLR responses

How should researchers approach studying MYADML2 in cancer models?

Based on studies of MAL family proteins in cancer, the following protocol is recommended for investigating MYADML2:

  • Expression analysis in cancer tissues:

    • Tissue microarray construction from cancer and adjacent normal tissues

    • Immunohistochemical staining with validated anti-MYADML2 antibodies

    • Scoring based on staining intensity (0-3) and proportion of positive cells (1-4)

    • Final score calculation: intensity score × proportion score (range: 0-12)

    • Classification: 0-5 as low expression, 6-12 as high expression

  • Survival analysis:

    • Kaplan-Meier analysis with patients stratified by MYADML2 expression

    • Log-rank test for statistical comparison

    • Multivariable Cox regression to adjust for clinical covariates

  • Functional studies:

    • Generate stable cell lines with MYADML2 overexpression or knockdown

    • For overexpression, use lentiviral vectors (lv-MYADML2)

    • For knockdown, use siRNA or shRNA approaches

    • Perform functional assays:

      • Cell proliferation: Seed cells at 1×100 cells/well in 96-well plates, measure growth using CCK-8 assay at 24h, 72h, 96h

      • Migration: Wound healing and Transwell assays

      • Drug sensitivity: Test response to chemotherapeutic agents like paclitaxel

  • Molecular mechanism investigation:

    • Western blot analysis of potential downstream targets

    • Focus on pathways relevant to cancer progression (e.g., EMT markers)

    • RNA-seq to identify global transcriptional changes

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.