Recombinant Human N-acetylaspartate synthetase (NAT8L)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt; aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Tag type is determined during production. Specify your required tag type during ordering to prioritize its inclusion.
Synonyms
NAT8L; CML3; N-acetylaspartate synthetase; NAA synthetase; Camello-like protein 3; N-acetyltransferase 8-like protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-302
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
NAT8L
Target Protein Sequence
MHCGPPDMVCETKIVAAEDHEALPGAKKDALLAAAGAMWPPLPAAPGPAAAPPAPPPAPV AQPHGGAGGAGPPGGRGVCIREFRAAEQEAARRIFYDGIMERIPNTAFRGLRQHPRAQLL YALLAALCFAVSRSLLLTCLVPAALLGLRYYYSRKVIRAYLECALHTDMADIEQYYMKPP GSCFWVAVLDGNVVGIVAARAHEEDNTVELLRMSVDSRFRGKGIAKALGRKVLEFAVVHN YSAVVLGTTAVKVAAHKLYESLGFRHMGASDHYVLPGMTLSLAERLFFQVRYHRYRLQLR EE
Uniprot No.

Target Background

Function

Recombinant Human N-acetylaspartate synthetase (NAT8L) plays a crucial role in lipogenesis regulation through the production of N-acetylaspartate (NAA), a brain-specific metabolite present in high concentrations. NAA hydrolysis is essential for maintaining white matter integrity. Furthermore, NAT8L promotes dopamine uptake by modulating TNF-alpha expression and attenuates methamphetamine-induced dopamine uptake inhibition.

Gene References Into Functions
  1. Lower NAT8L CpG island methylation ratios were observed in schizophrenia patients compared to healthy controls. PMID: 27348532
  2. The NAT8L gene, encoding ANAT, has been characterized and recombinantly expressed. PMID: 26550943
  3. NAA is synthesized specifically in NSCLC tumors due to NAT8L overexpression, and its extracellular secretion is detectable in blood. PMID: 26511490
  4. NAT8L is associated with reward dependence, a personality trait, and grey matter volume in the caudate nucleus, suggesting its potential influence on human personality. PMID: 24246274
  5. NAT8L impacts the brown adipogenic phenotype. PMID: 24155240
  6. Studies identified key protein regions critical for its catalytic activity and subcellular localization. PMID: 21936773
  7. NAT8L, unlike NAT14, catalyzes NAA synthesis from L-aspartate and acetyl-CoA. PMID: 19807691
Database Links

HGNC: 26742

OMIM: 610647

KEGG: hsa:339983

STRING: 9606.ENSP00000413064

UniGene: Hs.318529

Involvement In Disease
N-acetylaspartate deficiency (NACED)
Protein Families
Camello family
Subcellular Location
Cytoplasm. Membrane; Single-pass membrane protein. Microsome membrane; Single-pass membrane protein. Mitochondrion membrane; Single-pass membrane protein. Rough endoplasmic reticulum membrane; Single-pass membrane protein. Note=Its enzymatic activity contribution is quantitatively larger in mitochondrial compartment than in extramitochondrial compartment.
Tissue Specificity
Expressed in brain.

Q&A

What is the basic structure and function of human NAT8L?

Human NAT8L (N-acetyltransferase 8-like protein) is a 134 amino acid enzyme belonging to the camello protein family . The enzyme catalyzes the synthesis of N-acetylaspartate (NAA) from L-aspartate and acetyl-CoA . NAA is highly concentrated in the brain (approximately 10 mM), second only to glutamate .

NAT8L not only influences NAA synthesis but also affects neurotransmitter dynamics by promoting dopamine uptake through regulation of TNF-alpha expression and attenuating methamphetamine-induced inhibition of dopamine uptake .

What enzymatic parameters characterize recombinant human NAT8L activity?

When studying recombinant human NAT8L expressed in E. coli, researchers have established the following enzymatic parameters:

  • NAT8L activity exhibits linearity with respect to:

    • Incubation time (up to 30 minutes)

    • Protein concentration (up to 97.5 ng/μL)

  • Kinetic parameters include:

    • Km value for L-aspartate: 237 μM

    • Km value for acetyl-CoA: 11 μM

These kinetic properties indicate that NAT8L has a higher affinity for acetyl-CoA than for L-aspartate, a characteristic that may be significant when considering inhibitor design strategies. The enzyme shows reliable activity under standardized assay conditions, making it amenable to high-throughput screening approaches .

How does NAT8L activity integrate with cellular metabolism?

NAT8L activity is tightly integrated with central cellular metabolism through several key relationships:

  • NAA synthesis depends significantly on glutamine availability, as demonstrated in non-small cell lung cancer (NSCLC) cells .

  • The acetate moiety of NAA is primarily derived from glucose, establishing a direct link between glucose metabolism and NAA production .

  • Under glucose-limiting conditions, NAA appears to serve as a metabolic reservoir that can be mobilized to support cell survival .

  • NAA production may influence broader metabolic networks through its effects on UDP-sugar levels. Cells overexpressing NAT8L show increased levels of UDP-N-acetylglucosamine (UDP-GlcNAc), UDP-glucose, and UDP-galactose + UDP-glucuronate mixtures, which are crucial for protein glycosylation and cellular stress response .

This metabolic integration suggests that NAT8L is not merely an enzyme involved in producing a neural metabolite but plays a broader role in cellular adaptation to metabolic challenges.

What expression systems are optimal for producing recombinant human NAT8L?

Researchers have successfully produced recombinant human NAT8L using several expression systems, each with specific advantages depending on research objectives:

  • Wheat germ expression system: This platform has been used to produce full-length human NAT8L (amino acids 1-134) suitable for ELISA and Western blot applications . This system offers the advantage of a eukaryotic expression environment that may better preserve proper protein folding.

  • E. coli expression system: Bacterial expression has been successfully employed for producing human NAT8L for enzymatic assays, including high-throughput screening applications . This system typically provides higher protein yields but may require optimization to maintain native enzyme activity.

When selecting an expression system, researchers should consider:

  • The intended experimental application

  • Whether post-translational modifications are essential

  • Required protein yield and purity

  • Downstream assay compatibility

For structural studies or inhibitor screening, E. coli-expressed protein may be sufficient, while applications requiring detection of NAT8L in complex biological samples might benefit from protein expressed in the wheat germ system.

How can NAT8L activity be reliably measured in experimental settings?

Several complementary approaches have been developed to measure NAT8L activity with varying levels of sensitivity and throughput:

  • Fluorescence-based high-throughput screening (HTS) assay:

    • Optimized for linearity with incubation time (up to 30 minutes) and protein concentration (up to 97.5 ng/μL)

    • Suitable for screening large compound libraries

    • Enables determination of kinetic parameters (Km values: 237 μM for L-aspartate and 11 μM for acetyl-CoA)

  • Radioactive-based orthogonal assay:

    • Utilizes L-[U-14C] aspartate as substrate

    • Provides direct measurement of NAA synthesis

    • Valuable for confirming hits from primary screening and characterizing inhibitor mechanisms

  • Metabolomic approaches:

    • Gas chromatography-mass spectrometry (GC-MS) can quantify NAA levels in biological samples

    • Used successfully to detect NAA in tumor samples (4.5-56.7 μM; average 12.6 ± 4.6 μM)

  • Genetic validation:

    • siRNA-mediated knockdown of NAT8L followed by measurement of NAA levels

    • In H1299 lung cancer cells, NAT8L suppression reduced intracellular NAA by 72%

When selecting a method, researchers should consider the required sensitivity, throughput needs, and whether direct enzyme activity or downstream metabolite measurements are more appropriate for their specific research question.

What methods can be used to study NAT8L in cellular and in vivo contexts?

To investigate NAT8L function in more complex biological systems, researchers have developed several approaches:

  • Genetic manipulation strategies:

    • siRNA knockdown: Effective for transient reduction of NAT8L expression, as demonstrated in H1299 cells where suppression with si(NAT8L)#1 led to 72% reduction in intracellular NAA

    • Overexpression models: Stable cell lines overexpressing NAT8L (Nat8l o/e) allow for studying the metabolic consequences of increased NAA production

  • Metabolic labeling and flux analysis:

    • [U-13C]-Glucose and [U-13C]-Glutamine labeling has revealed that the acetate moiety of NAA is predominantly derived from glucose

    • These approaches enable tracking of carbon flux through NAA biosynthesis pathways

  • Clinical sample analysis:

    • NAA can be detected in resected tumor samples using GC-MS (detected in 10 of 11 NSCLC samples)

    • A sensitive blood assay for NAA has been developed, showing elevated NAA blood levels in 46% of NSCLC patients compared to age-matched healthy controls

  • Transcriptomic analysis:

    • Analysis of NAT8L expression in public databases like TCGA can reveal disease-specific patterns

    • In NSCLC, elevated NAT8L expression was found in approximately 40% of adenocarcinoma and squamous cell carcinoma cases

When designing experiments to study NAT8L in cellular contexts, researchers should consider the specific biological question, the appropriate model system, and whether enzyme activity, NAA levels, or broader metabolic effects are the primary focus.

How is NAT8L involved in neurological disorders, particularly Canavan disease?

NAT8L plays a critical role in the pathophysiology of Canavan disease (CD), a fatal neurological disorder resulting from mutations in aspartoacyclase (ASPA), the enzyme that deacetylates NAA:

  • Pathological mechanism: In CD, defective ASPA leads to NAA accumulation, which is toxic at high levels. Since NAT8L continuously produces NAA, the imbalance between production and breakdown creates a metabolic crisis .

  • Genetic evidence: Genetic deletion of NAT8L leads to normalization of NAA levels and symptom improvement in mouse models of CD, providing proof-of-concept that reducing NAA production can be therapeutic .

  • Developmental dysregulation: In ASPA null (Nur7) mice, NAT8L is upregulated during early postnatal development—a period normally characterized by low NAT8L expression and increased ASPA expression .

  • Therapeutic implications: Pharmacological inhibition of NAT8L represents a promising therapeutic strategy for CD, though no clinically viable inhibitors currently exist .

This evidence establishes NAT8L as a key target for CD treatment approaches that aim to restore the balance between NAA production and breakdown.

What evidence supports NAT8L's role in cancer metabolism?

Emerging research has revealed a previously unknown role for NAT8L in cancer, particularly in non-small cell lung cancer (NSCLC):

  • Cancer-specific expression:

    • NAA was identified as a unique metabolic compound in NSCLC cells that was undetectable in normal lung epithelium

    • NAA was detected in 10 of 11 NSCLC patient tumor samples (4.5-56.7 μM; average 12.6 ± 4.6 μM) but not in any of 5 non-malignant lung tissues

  • Expression pattern in clinical samples:

    • TCGA database analysis revealed elevated NAT8L expression in approximately 40% of adenocarcinoma and squamous cell carcinoma cases (n=577)

    • Among 55 lung adenocarcinoma tumors with patient-matched normal tissues, 44% showed significant NAT8L elevation

  • Functional validation:

    • siRNA knockdown of NAT8L in NSCLC cells selectively reduced both intracellular NAA (by 72%) and extracellular NAA secretion

    • NAA biosynthesis in NSCLC cells depends on glutamine availability, linking NAT8L to cancer-associated glutamine metabolism

  • Biomarker potential:

    • NAA blood levels were elevated in 46% of NSCLC patients compared to age-matched healthy controls among individuals aged 55 years or younger

    • The blood assay showed consistent results with samples stored at -80°C for up to 7 years, with an intra-assay variability of 12%

These findings suggest that NAT8L overexpression and subsequent NAA production may provide metabolic advantages to cancer cells and could potentially serve as a biomarker for a subset of lung cancer patients.

How does NAT8L function change under metabolic stress conditions?

NAT8L plays a significant role in cellular adaptation to metabolic stress, particularly under glucose-limiting conditions:

  • Cell survival enhancement:

    • Cells overexpressing NAT8L demonstrate improved survival rates under glucose limitation

    • NAA supplementation can rescue cell viability in glucose-limited conditions

    • This rescue effect is superior to supplementation with aspartate or acetate alone, suggesting that the intact NAA molecule provides unique advantages

  • ER stress modulation:

    • NAA appears to improve endoplasmic reticulum (ER) stress response and protein synthesis rates under stress conditions

    • This effect may contribute to enhanced cellular resilience during metabolic challenge

  • UDP-sugar metabolism:

    • NAA increases intracellular levels of UDP-sugars, including UDP-N-acetylglucosamine (UDP-GlcNAc)

    • UDP-GlcNAc sustains protein glycosylation, which reduces ER stress and promotes protein synthesis

    • This represents a potential mechanism through which NAA confers metabolic advantages

These findings suggest that one major role of NAA is to modulate ER stress and protein synthesis particularly when glucose is limiting, potentially explaining why certain cancer cells upregulate NAT8L expression.

What approaches are being used to develop potential NAT8L inhibitors?

Development of NAT8L inhibitors represents an active area of research with potential therapeutic applications. Current approaches include:

  • High-throughput screening (HTS) pipeline:

    • A fluorescence-based primary assay has been optimized for screening compound libraries

    • In one pilot study, screening of a 10,000-compound library identified initial hits

    • Hits from fluorescence-based screening can be validated using an orthogonal radioactive-based assay with L-[U-14C] aspartate

  • Inhibitor characterization:

    • Detailed kinetic analysis has revealed that compounds can exhibit different inhibitory mechanisms:

      • Uncompetitive inhibition with respect to L-aspartate

      • Noncompetitive inhibition against acetyl-CoA

    • This mechanistic information is valuable for rational inhibitor optimization

  • Cellular validation:

    • Promising compounds can be tested for their ability to reduce NAA levels in cellular systems

    • Effects on related metabolites should be monitored to assess specificity

    • Comparison with siRNA-mediated NAT8L knockdown provides a reference point for expected effects

The screening cascade developed for NAT8L inhibitor discovery enables large-scale compound library screening to identify novel inhibitors as leads for further medicinal chemistry optimization . These efforts are particularly relevant for potential therapies targeting Canavan disease and specific cancer types that overexpress NAT8L.

What are the proposed functions of NAA beyond myelin synthesis?

While NAA's role in providing acetyl groups for myelin synthesis is well-established, research has revealed several additional functions:

  • Metabolic adaptation:

    • NAA improves cell survival when glucose is limiting

    • NAA may serve as a metabolic reservoir of acetate groups that can be mobilized during nutrient scarcity

  • ER stress and protein synthesis regulation:

    • NAA increases intracellular levels of UDP-sugars, including UDP-N-acetylglucosamine (UDP-GlcNAc)

    • UDP-GlcNAc sustains protein glycosylation, which reduces ER stress and promotes protein synthesis

    • This mechanism appears particularly important under metabolic stress conditions

  • Neurotransmitter regulation:

    • NAT8L promotes dopamine uptake by regulating TNF-alpha expression

    • It attenuates methamphetamine-induced inhibition of dopamine uptake

    • This suggests NAA metabolism may influence neurotransmitter dynamics

  • Intercellular signaling:

    • Evidence from ASPA null (Nur7) mice suggests signaling mechanisms involving cross-talk between neurons and oligodendrocytes

    • This signaling appears to control NAA metabolism during both postnatal development and neurodegenerative disease progression

These diverse functions highlight NAA as a multifunctional molecule with roles extending well beyond myelin synthesis, particularly in cellular metabolism, stress response, and possibly intercellular communication.

How can NAT8L activity be manipulated to study its functional effects?

Researchers have developed several complementary approaches to manipulate NAT8L activity and study the resulting functional consequences:

  • Genetic modulation:

    • siRNA-mediated knockdown: Effective for transient reduction of NAT8L expression, as demonstrated in H1299 cells where si(NAT8L)#1 reduced intracellular NAA by 72%

    • Stable overexpression: Establishing Nat8l overexpressing (Nat8l o/e) cell lines allows for studying the metabolic consequences of increased NAA production

    • ASPA knockdown or overexpression: Manipulating the enzyme that breaks down NAA provides complementary insights into NAA metabolism

  • Pharmacological approaches:

    • NAA supplementation: Adding exogenous NAA to cells can rescue phenotypes associated with NAT8L knockdown or inhibition

    • Combined aspartate and acetate supplementation: This approach tests whether the precursor metabolites can substitute for NAA itself

    • Inhibitor compounds: While still in development, compounds identified through screening efforts can be valuable probe molecules

  • Metabolic manipulation:

    • Nutrient limitation: Glucose restriction reveals NAA's role in metabolic adaptation

    • [U-13C]-Glucose and [U-13C]-Glutamine labeling: These approaches track carbon flux through NAA biosynthesis pathways and reveal substrate utilization patterns

By combining these approaches, researchers can dissect the specific roles of NAT8L and NAA in different biological contexts and under varying metabolic conditions. This multifaceted strategy is essential for understanding the complex functions of this enzyme-metabolite system.

What are the challenges in translating NAT8L research into clinical applications?

Despite promising research, several challenges must be addressed to translate NAT8L findings into clinical applications:

  • Technical challenges in biomarker development:

    • NAA blood assays require high sensitivity to detect nanomolar concentrations

    • Intra-subject, inter-assay, and inter-laboratory variabilities need thorough evaluation

    • Sample collection and storage standardization is critical for reliable results

  • Target population definition:

    • For cancer applications, approximately 40% of NSCLC patients show NAT8L overexpression

    • For neurological disorders, patient stratification criteria need refinement

    • Age considerations are important, as NAA blood levels appear more discriminatory in patients under 55 years

  • Therapeutic development hurdles:

    • For Canavan disease, NAT8L inhibitors must penetrate the blood-brain barrier

    • For cancer applications, differential effects on normal brain tissue must be addressed

    • Medicinal chemistry optimization is needed to improve potency and specificity of identified hits

  • Physiological complexity:

    • NAA has important physiological roles, raising concerns about potential side effects

    • The relationship between NAT8L expression and disease progression requires further characterization

    • Understanding whether NAT8L changes are causative or compensatory in disease states is crucial

Addressing these challenges will require collaborative efforts across disciplines, including biochemistry, medicinal chemistry, clinical research, and biomarker development.

What are promising future research directions for NAT8L biology?

Several promising research directions could significantly advance our understanding of NAT8L biology:

  • Structural biology approaches:

    • Determining the high-resolution structure of human NAT8L

    • Understanding substrate binding and catalytic mechanisms

    • Structure-based design of selective inhibitors

  • Systems biology integration:

    • Elucidating how NAT8L activity is integrated with broader metabolic networks

    • Understanding the cross-talk between NAA metabolism and other pathways

    • Computational modeling of NAA's role in cellular metabolism

  • Expanded clinical investigations:

    • Larger validation studies of NAA as a cancer biomarker

    • Longitudinal studies correlating NAT8L expression with disease progression

    • Clinical trials of NAT8L inhibitors for Canavan disease when viable candidates emerge

  • Mechanistic studies of NAA functions:

    • Further investigation of NAA's role in ER stress response

    • Detailed characterization of how NAA influences UDP-sugar metabolism

    • Exploration of potential signaling roles beyond metabolism

  • Therapeutic development:

    • Optimization of lead compounds identified from screening efforts

    • Development of delivery systems for brain-targeted NAT8L inhibition

    • Exploration of combination approaches, particularly for cancer applications

These research directions could lead to significant advances in both our fundamental understanding of NAA biology and the development of novel therapeutic strategies for conditions involving dysregulated NAA metabolism.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.