Recombinant Human N-acetylglucosamine-1-phosphotransferase subunits alpha/beta (GNPTAB), partial

Shipped with Ice Packs
In Stock

Description

General Information

The GNPTAB gene encodes the alpha and beta subunits of GlcNAc-1-phosphotransferase, an enzyme crucial for transporting newly formed enzymes to lysosomes . Lysosomes are cell compartments containing hydrolases, which are digestive enzymes that break down large molecules for cellular reuse . The complete GlcNAc-1-phosphotransferase enzyme consists of two alpha, two beta, and two gamma subunits; the gamma subunit is encoded by the GNPTG gene .

Function of GlcNAc-1-phosphotransferase

GlcNAc-1-phosphotransferase initiates the synthesis of mannose-6-phosphate (M6P), which acts as a tag to direct hydrolases to the lysosome . The enzyme transfers GlcNAc-1-phosphate to a newly produced hydrolase, marking it for transport to the lysosome .

Role in Disease

Mutations in GNPTAB can cause mucolipidosis II (MLII) and mucolipidosis III alpha/beta (MLIII α/β), which are autosomal recessive diseases . These conditions result from a deficiency in the alpha and beta subunits of N-acetylglucosamine-1-phosphotransferase . A comprehensive analysis of patients with MLII and MLIII alpha/beta showed that pathogenic variants in GNPTAB result in increased bone resorption .

Impact of GNPTAB Mutations on Enzyme Activity

The location of mutations within the GNPTAB gene affects GlcNAc-1-phosphotransferase activity and determines the clinical phenotype of patients . Studies measuring GlcNAc-1-phosphotransferase activity have shown that the expression of wild-type α/β-subunit precursors leads to a significant increase in enzyme activity compared to non-transfected cells .

GNPTAB Mutations and Stuttering

Research indicates that GNPTAB mutations found in human stuttering can affect mouse ultrasonic vocalizations (USV) . Mice engineered with these mutations displayed elevated plasma levels of lysosomal acid hydrolases, similar to what is observed in humans with mucolipidosis types II and III .

Table 1: Plasma Activity of Acid Hydrolases in Gnptab Ser321Gly Mice Compared to Wild-Type Mice

Acid HydrolaseWild-Type Mice (Units)Gnptab Ser321Gly Mice (Units)Fold Increasep-value
β-HexosaminidaseXX+1.261.26< 0.05
α-MannosidaseYY+3.33.3< 0.001
β-MannosidaseZZ+2.52.5< 0.001
β-GalactosidaseAA (No significant difference)N/A> 0.05
β-GlucuronidaseBB (No significant difference)N/A> 0.05

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If a specific tag type is required, please inform us, and we will prioritize its development.
Synonyms
GNPTAB; GNPTA; KIAA1208; N-acetylglucosamine-1-phosphotransferase subunits alpha/beta; GlcNAc-1-phosphotransferase subunits alpha/beta; Stealth protein GNPTAB; UDP-N-acetylglucosamine-1-phosphotransferase subunits alpha/beta
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
929-1256
Protein Length
partial
Species
Homo sapiens (Human)
Target Names
GNPTAB
Target Protein Sequence
DTFADSLRYVNKILNSKFGFTSRKVPAHMPHMIDRIVMQELQDMFPEEFDKTSFHKVRHS EDMQFAFSYFYYLMSAVQPLNISQVFDEVDTDQSGVLSDREIRTLATRIHELPLSLQDLT GLEHMLINCSKMLPADITQLNNIPPTQESYYDPNLPPVTKSLVTNCKPVTDKIHKAYKDK NKYRFEIMGEEEIAFKMIRTNVSHVVGQLDDIRKNPRKFVCLNDNIDHNHKDAQTVKAVL RDFYESMFPIPSQFELPREYRNRFLHMHELQEWRAYRDKLKFWTHCVLATLIMFTIFSFF AEQLIALKRKIFPRRRIHKEASPNRIRV
Uniprot No.

Target Background

Function
This enzyme catalyzes the formation of mannose 6-phosphate (M6P) markers on high-mannose type oligosaccharides within the Golgi apparatus. These M6P residues are essential for binding to mannose 6-phosphate receptors (MPRs), mediating the vesicular transport of lysosomal enzymes to the endosomal/prelysosomal compartment.
Gene References Into Functions

Relevant Research: The following publications highlight the functional significance of GNPTAB and its association with various conditions.

  1. Diagnosis challenges in Mucolipidosis II, often presenting with rickets-like symptoms: PMID: 30204966
  2. GNPTAB, GNPTG, and NAGPA gene variations: PMID: 29289611
  3. GNPTAB missense mutations and loss of GlcNAc-1-phosphotransferase activity in mucolipidosis type II: PMID: 28918368
  4. GNPTAB mutations and mucolipidosis II: PMID: 27180337
  5. GNPTAB mutations and mucolipidosis type III: PMID: 27710913
  6. Novel homozygous missense variant in GNPTAB in MLIIIalpha/beta: PMID: 26749367
  7. GNPTAB mutations and persistent stuttering: PMID: 26130485
  8. GlcNAc-1-phosphotransferase substrate recognition mechanism: PMID: 26833567
  9. GlcNAc-1-phosphotransferase gamma-subunit binding: PMID: 26385638
  10. GNPTAB and NAGPA SNPs association with developmental dyslexia: PMID: 25643770
  11. Intermediate mucolipidosis II/IIIalphabeta caused by GNPTAB mutation: PMID: 24045841
  12. Mouse model of MLII with GNPTAB mutation: PMID: 25107912
  13. Missense and frameshift mutations and severe clinical phenotype: PMID: 24375680
  14. Missense mutations and mistargeting of phosphotransferases: PMID: 24550498
  15. Homozygous nonsense mutations in GNPTAB and mucolipidosis II alpha/beta: PMID: 23773965
  16. DMAP interaction domain and acid hydrolase substrate recognition: PMID: 23733939
  17. Novel splice site mutation in exon 14 of GNPATB gene: PMID: 23566849
  18. PT complex sorting motif and coat protein complex II: PMID: 23192343
  19. GNPTAB, GNPTG, NAGPA mutations and stuttering (review): PMID: 22884963
  20. c.3503_3504delTC deletion and common haplotype in Mucolipidosis II: PMID: 20880125
  21. Compound heterozygous mutations in GNPTAB gene: PMID: 21549105
  22. Glu1200Lys mutation in GNPTAB and persistent stuttering: PMID: 20944643
  23. Proteolytic processing of gamma-subunit and GlcNAc-1-phosphotransferase activity: PMID: 20489197
  24. GNPTAB mutations in subjects with stuttering: PMID: 20147709
  25. Pathogenic changes in GNPTAB and mucolipidoses II and III alpha/beta: PMID: 19617216
  26. GNPTAB mutations and Mucolipidoses: PMID: 19634183
  27. GNPTAB gene analysis in Mucolipidosis II and ML III Japanese patients: PMID: 19197337
  28. GNPTAB alpha and beta subunits encoded by a single cDNA: PMID: 16120602
  29. GNPTA subunit of GlcNAc-1-phosphotransferase and mucolipidosis II: PMID: 16200072
  30. Mutations in GNPTAB and Mucolipidosis II or mucolipidosis IIIA: PMID: 16465621
  31. GNPTA mutations and Mucolipidosis II or ML III phenotype: PMID: 16630736
  32. c.3503_3504delTC deletion and founder effect in Saguenay-Lac-Saint-Jean population: PMID: 18190596
  33. Mutations in GNPTAB and GNPTG genes in mucolipidosis II and III patients: PMID: 19659762
Database Links

HGNC: 29670

OMIM: 252500

KEGG: hsa:79158

STRING: 9606.ENSP00000299314

UniGene: Hs.46850

Involvement In Disease
Mucolipidosis type II (MLII); Mucolipidosis type III complementation group A (MLIIIA)
Protein Families
Stealth family
Subcellular Location
[N-acetylglucosamine-1-phosphotransferase subunit alpha]: Golgi apparatus membrane; Single-pass type I membrane protein.; [N-acetylglucosamine-1-phosphotransferase subunit beta]: Golgi apparatus membrane; Single-pass type II membrane protein.
Tissue Specificity
Expressed in the heart, whole brain, placenta, lung, liver, skeletal muscle, kidney and pancreas.

Q&A

What is the structure and function of recombinant human GNPTAB?

GNPTAB encodes the alpha and beta subunits of N-acetylglucosamine-1-phosphotransferase (GlcNAc-1-phosphotransferase), a heterohexameric complex composed of two alpha, two beta, and two gamma subunits. The gamma subunits are encoded by a separate gene, GNPTG. The enzyme catalyzes the initial step in the formation of mannose-6-phosphate (M6P) markers on high mannose-type oligosaccharides of newly synthesized lysosomal hydrolases .

The encoded protein is proteolytically cleaved at the Lys928-Asp929 bond to yield mature alpha and beta polypeptides . In the Golgi apparatus, this complex catalyzes the transfer of GlcNAc-1-phosphate to newly produced hydrolases, creating recognition markers essential for appropriate trafficking of lysosomal enzymes .

Recent crystallographic studies have revealed that four segments dispersed across the primary sequence assemble into a compact catalytic domain. The donor substrate UDP-N-acetylglucosamine is tightly bound in the active site cavity, exposing one phosphate group .

How do missense mutations in GNPTAB affect enzyme activity and disease phenotypes?

Missense mutations in GNPTAB can affect enzyme activity in various ways, resulting in a spectrum of disease phenotypes. Analysis of patient mutations has provided insights into functional domains of αβ GlcNAc-1-phosphotransferase .

The K732N patient mutation in the DMAP interaction domain results in impaired binding and decreased phosphorylation of lysosomal acid hydrolases without affecting catalytic activity toward α-methyl d-mannoside (α-MM), implicating the DMAP domain as a protein substrate recognition module .

The K4Q and S15Y patient mutations within the N-terminal cytoplasmic tail of the α subunit decrease retention of catalytically active enzyme in the Golgi complex, indicating these residues play a role in enzyme trafficking .

Plasma enzyme activity measurements in mouse models carrying GNPTAB mutations show:

EnzymeWild-typeSer321Gly MutantFold Increase
β-hexosaminidaseNormalElevated1.26-3.3x
α-mannosidaseNormalElevated1.26-3.3x
β-mannosidaseNormalElevated1.26-3.3x
β-galactosidaseNormalNo significant change-
β-glucuronidaseNormalNo significant change-

These results indicate that missense mutations have functional effects on the biological activity of the lysosomal targeting function but are less severe than complete knockout .

What expression systems are most effective for producing recombinant GNPTAB?

For recombinant GNPTAB expression, several systems have proven effective depending on research objectives:

  • Mammalian Expression Systems: HEK293 and CHO cell lines are preferred for producing functional GNPTAB with proper post-translational modifications, particularly important when studying enzyme activity and trafficking. These systems support proper folding and proteolytic processing at the Lys928-Asp929 site .

  • Site-Directed Mutagenesis Approach: For studying specific mutations, QuikChange site-directed mutagenesis has been successfully employed to generate variants such as C447Y and C473S using primers:

    • C447Y: 5′-CAA ATT GTG CTG AGG GCT ATC CAG GAT CCT GGA TCA AAG-3′ and 5′-CTT TGA TCC AGG ATC CTG GAT AGC CCT CAG CAC AAT TTG-3′

    • C473S: 5′-GGG ATG GAG GAG ACT CTC AAG GCA GCA GTC G-3′ and 5′-CGA CTG CTG CCT TGA GAG TCT CCT CCA TCC C-3′

  • Zebrafish Model: For studying developmental aspects, zebrafish expression systems have been used to analyze GNPTAB function in vivo .

When expressing full-length GNPTAB, it's essential to monitor proteolytic processing, as this cleavage is necessary for enzyme maturation and function.

What assays are available for measuring GNPTAB enzyme activity?

Several established assays can measure GNPTAB enzyme activity effectively:

  • Lysosomal Hydrolase Phosphorylation Assay: This assay measures the transfer of GlcNAc-1-phosphate to lysosomal hydrolases in the presence of UDP-N-acetylglucosamine. The absence of this activity is diagnostic in I-cell fibroblasts .

  • Cathepsin D Sorting Assay: This assay evaluates the efficiency of intracellular retention of newly synthesized cathepsin D, providing insight into the functional status of the mannose-6-phosphate pathway. In patients with intermediate ML II/III, despite reduced GNPT activity (7-12%), the majority of newly synthesized cathepsin D remains intracellular .

  • Plasma Acid Hydrolase Activity: Measuring the activity of multiple acid hydrolases (β-hexosaminidase, α-mannosidase, β-mannosidase, β-galactosidase, and β-glucuronidase) in plasma can indirectly assess GNPTAB function. Elevated plasma levels indicate impaired lysosomal targeting .

  • In Vitro Phosphotransferase Activity: This assay uses purified recombinant enzyme with synthetic acceptor substrates such as α-methyl d-mannoside (α-MM) to measure catalytic activity directly .

What is the proposed catalytic mechanism of GlcNAc-1-phosphotransferase based on recent structural studies?

Recent crystallographic studies have revealed critical insights into the catalytic mechanism of GlcNAc-1-phosphotransferase. The reaction likely occurs in one step, without a covalent enzyme intermediate .

The proposed mechanism involves:

  • The mannose 6-hydroxyl carries out a nucleophilic attack on the β phosphate of UDP-GlcNAc.

  • This phosphate is stabilized and neutralized by the positively charged Arg986, Mg1, and Asn1151.

  • The leaving α phosphate group is also stabilized by Arg986 and Mg1.

  • Nucleophilic attack is enabled by deprotonation of the mannose 6-hydroxyl by His956, which is the only residue suitably located for this purpose .

Key residue mutations have confirmed this mechanism:

  • Mutation of Asn1151 decreased activity 200-fold

  • Conservative substitution Arg986Lys abolished the reaction

  • His956Asn/Gln mutants severely impaired activity while preserving the His956 H-bond to the GlcNAc moiety

These residues (Arg956, His986, and Asp408, which coordinates Mg1) are strictly conserved in the Stealth family of related enzymes, further supporting this mechanism .

How do GNPTAB mutations identified in human stuttering differ functionally from those causing mucolipidosis?

GNPTAB mutations causing stuttering and those causing mucolipidosis show different functional consequences and severity:

Stuttering Mutations:

  • Mutations such as Ser321Gly in GNPTAB cause partial deficiency in mannose-6-phosphate targeting function.

  • Mouse models with the Ser321Gly mutation display 1.26-3.3-fold increases in plasma hydrolase activity for specific enzymes (β-hexosaminidase, α-mannosidase, and β-mannosidase) but not for all lysosomal enzymes.

  • These mutations are associated with abnormal ultrasonic vocalizations (USVs) in mice, with increased pause durations between syllables, similar to human stuttering .

  • Astrocyte-specific conditional knockouts of GNPTAB show significant effects on vocalization, suggesting cell-type-specific pathology .

  • Brain imaging and histology show corpus callosum abnormalities, consistent with interhemispheric connection deficits proposed in stuttering .

Mucolipidosis Mutations:

  • Complete loss-of-function mutations in GNPTAB cause severe mucolipidosis type II.

  • Partial loss-of-function mutations cause the milder mucolipidosis type III α/β.

  • Plasma levels of lysosomal acid hydrolases are dramatically elevated (7-14-fold) in complete knockout models .

  • Intermediate mutations like c.10A>C/p.K4Q cause an intermediate ML II/III phenotype with physical features resembling ML II but psychomotor development and life expectancy similar to ML III α/β .

These differences highlight how the degree of enzyme deficiency and specific functional domains affected determine the resulting phenotype, with stuttering mutations generally causing milder and more selective deficits than those causing mucolipidosis.

What are the critical functional domains of GNPTAB and how do they contribute to substrate recognition?

GNPTAB contains several functional domains that play specific roles in enzyme activity and substrate recognition:

  • N-Terminal Cytoplasmic Tail (α subunit):

    • Contains residues K4 and S15, which are critical for Golgi retention

    • Mutations K4Q and S15Y decrease enzyme retention in the Golgi complex

    • The c.10A>C (p.K4Q) mutation causes an intermediate ML II/III phenotype

  • DMAP Interaction Domain:

    • Functions as a protein substrate recognition module

    • The K732N patient mutation impairs binding and decreases phosphorylation of lysosomal acid hydrolases

    • Maintains catalytic activity toward simple sugar substrates like α-methyl d-mannoside

  • Catalytic Domain:

    • Composed of four segments dispersed across the primary sequence that assemble into a compact structure

    • Contains the active site that binds UDP-GlcNAc

    • Key catalytic residues include His956, Arg986, and Asn1151

    • Conserved Asp408 coordinates Mg1, which is essential for catalysis

  • Cleavage Site:

    • Located at Lys928-Asp929 bond

    • Proteolytic processing at this site yields mature alpha and beta polypeptides

    • Critical for enzyme maturation and function

  • Notch Domains:

    • Present in the protein structure and mentioned in keyword listings

    • May contribute to protein-protein interactions or structural stability

Understanding these domains has practical implications for designing targeted therapeutic approaches and interpreting patient mutations in different regions of the protein.

What methodologies are most effective for studying GNPTAB-related pathology in animal models?

Several methodologies have proven effective for studying GNPTAB-related pathology in animal models:

  • Knockin Mouse Models with Patient Mutations:

    • Generation of Ser321Gly and Ala455Ser knockin mice to model human stuttering mutations

    • Allows direct correlation between specific mutations and phenotypic consequences

    • Permits study of partial loss-of-function effects relevant to human disease

  • Conditional Knockout Strategies:

    • Creation of mice carrying loxP sequences flanking exon 2 of Gnptab

    • Cell-type specific deletion using Cre drivers (e.g., Gfap-cre for astrocyte-specific deletion)

    • Enables identification of cell types critical for specific phenotypes

    • Breeding strategy: Positioning floxed exon 2 on one chromosome and either wild-type or fully deleted exon 2 on the other chromosome maximizes recombinase efficiency

  • Vocalization Analysis:

    • Recording and analyzing ultrasonic vocalizations (USVs) in mouse pups

    • Measuring parameters such as syllable structure, frequency, and interbout pause durations

    • Correlating vocalization abnormalities with human stuttering phenotypes

  • Immunohistochemistry and Colocalization Studies:

    • Confirmation of cell-type specific knockout using anti-Gnptab and cell-type markers

    • Quantification of colocalization (e.g., Gnptab in Gfap-positive cells reduced from 36.6±3.1% in wild-type to 15.3±2.4% in conditional knockouts)

    • Assessment of astrocyte and microglial activation using specific markers

  • Diffusion Tensor Imaging (DTI):

    • Non-invasive assessment of brain structural abnormalities

    • Identification of corpus callosum abnormalities in Gnptab mutant mice

    • Correlation with human brain imaging findings in stuttering

  • Zebrafish Models:

    • Useful for studying developmental aspects of GNPTAB function

    • Allows high-throughput screening of mutations and interventions

How can researchers differentiate between the biochemical consequences of different GNPTAB mutations?

Researchers can employ several approaches to differentiate between the biochemical consequences of different GNPTAB mutations:

  • Enzymatic Activity Profiling:

    • Measuring GlcNAc-1-phosphotransferase activity using both natural substrates (lysosomal hydrolases) and synthetic substrates (α-methyl d-mannoside)

    • Comparing activity ratios between different substrates can reveal domain-specific effects

    • For example, K732N mutation in the DMAP domain showed decreased activity toward lysosomal hydrolases but normal activity toward α-MM

  • Plasma Hydrolase Activity Panel:

    • Analyzing multiple lysosomal hydrolases (β-hexosaminidase, α-mannosidase, β-mannosidase, β-galactosidase, β-glucuronidase)

    • Different mutation types show distinct patterns of plasma enzyme elevation:

      • Complete knockout: 7-14 fold increase in all enzymes

      • Stuttering mutations (e.g., Ser321Gly): 1.26-3.3 fold increase in select enzymes

      • Intermediate ML II/III mutations: 2-5 fold increases

  • Subcellular Localization Studies:

    • Immunofluorescence microscopy to track enzyme localization

    • Mutations in the N-terminal cytoplasmic domain (K4Q, S15Y) specifically affect Golgi retention

    • Co-localization with Golgi markers can quantify retention efficiency

  • Proteolytic Processing Analysis:

    • Western blotting to assess cleavage at the Lys928-Asp929 site

    • Mutations affecting this processing would show altered ratios of precursor to mature forms

  • Structural Analysis through Targeted Mutagenesis:

    • Creating mutations of specific catalytic residues (His956, Arg986, Asn1151)

    • Comparing the effects of patient mutations to these known functional residues

    • Provides insight into mechanism of pathogenicity

  • Mannose-6-Phosphate Quantification:

    • Direct measurement of M6P residues on lysosomal hydrolases using mass spectrometry

    • Allows quantitative assessment of the functional consequence of different mutations on the actual targeting signal

What are the recommended protocols for purifying recombinant GNPTAB for structural studies?

Based on recent structural studies and biochemical characterizations, the following protocol is recommended for purifying recombinant GNPTAB for structural studies:

  • Expression System Selection:

    • Mammalian expression systems (HEK293 or CHO cells) are preferred for full-length GNPTAB to ensure proper post-translational modifications and proteolytic processing

    • For isolated domains (e.g., catalytic domain), bacterial expression may be suitable after optimization of codon usage and solubility tags

  • Construct Design:

    • Include a C-terminal affinity tag (His6 or twin-Strep) for purification

    • Consider expressing the catalytic domain separately if full-length protein proves challenging

    • For co-expression with gamma subunits, bicistronic vectors expressing both GNPTAB and GNPTG can improve complex stability

  • Cell Lysis and Membrane Protein Extraction:

    • Use gentle detergents like DDM (n-dodecyl-β-D-maltopyranoside) or LMNG (lauryl maltose neopentyl glycol) for extraction

    • Include protease inhibitors to prevent degradation

    • Consider adding UDP-GlcNAc during purification to stabilize the active site

  • Affinity Chromatography:

    • First purification step using affinity tag (Ni-NTA for His-tagged constructs)

    • Wash extensively to remove contaminants while maintaining detergent concentration above CMC

  • Size Exclusion Chromatography:

    • Final purification step to obtain homogeneous protein preparation

    • Monitor for heterohexameric assembly (α2β2γ2) or specific domains as appropriate

    • Assess protein quality using SDS-PAGE and western blotting for both alpha and beta subunits

  • Protein Characterization:

    • Verify enzyme activity using phosphotransferase assays

    • Assess protein stability through thermal shift assays

    • Confirm oligomeric state using multi-angle light scattering

For crystallization specifically, consider:

  • Screening various detergents and lipids for optimal stability

  • Testing limited proteolysis to identify stable core domains

  • Employing surface entropy reduction mutations to promote crystal contacts

How can researchers accurately measure GlcNAc-1-phosphotransferase activity in patient samples?

Accurate measurement of GlcNAc-1-phosphotransferase activity in patient samples requires careful consideration of sample preparation, assay conditions, and appropriate controls:

  • Sample Preparation:

    • Fibroblasts are the preferred cell type for diagnostic testing

    • Lyse cells in buffer containing detergent (e.g., Triton X-100) to solubilize membrane-bound enzyme

    • Centrifuge at high speed to remove insoluble material

    • Normalize protein concentration across samples

  • Enzymatic Assay Methods:

    • Direct Activity Measurement:

      • Incubate cell lysates with UDP-[³H]GlcNAc and purified lysosomal hydrolases (e.g., cathepsin D)

      • Measure transfer of radioactive GlcNAc-1-phosphate to acceptor proteins

      • Separate products by SDS-PAGE or precipitation with phosphotungstic acid

    • Indirect Assessment via Plasma Hydrolase Activity:

      • Measure activity of multiple lysosomal hydrolases in patient plasma

      • Compare to age-matched controls

      • Elevated plasma activities indicate GNPTAB dysfunction

  • Controls and Standardization:

    • Include normal control fibroblasts processed identically to patient samples

    • Use fibroblasts from known mucolipidosis II patients as positive disease controls

    • Perform assays in triplicate to ensure reproducibility

    • Include internal standard proteins with known phosphorylation efficiency

  • Data Analysis and Interpretation:

    • Calculate enzyme activity as pmol GlcNAc-1-phosphate transferred per hour per mg protein

    • In mucolipidosis II, activity is typically <1% of normal

    • In mucolipidosis III, activity ranges from 1-10% of normal

    • In intermediate phenotypes, activity is typically 7-12% of normal

    • Minor reductions may be seen in carriers (heterozygotes)

  • Complementary Assays:

    • Cathepsin D sorting assay to assess functional consequences

    • Immunoblotting to detect GNPTAB protein levels and processing

    • Sequencing of GNPTAB to identify specific mutations

This comprehensive approach provides both quantitative measurement of enzyme activity and qualitative assessment of functional consequences, enabling accurate diagnosis and phenotype prediction.

What are the most effective approaches for generating GNPTAB knockout or knockin models?

Several effective approaches have been developed for generating GNPTAB knockout or knockin models, each with specific advantages:

  • CRISPR/Cas9 for Knockin Models:

    • Most efficient method for introducing specific patient mutations

    • Design guide RNAs targeting near the desired mutation site

    • Provide repair template containing the desired mutation flanked by homology arms

    • Screen founders by PCR and sequence verification

    • Successfully used to generate Ser321Gly and Ala455Ser knockin mice modeling human stuttering mutations

  • Conditional Knockout Strategy:

    • LoxP sites can be introduced flanking critical exons (e.g., exon 2 of Gnptab)

    • Embryonic stem cells with such modifications are available through repositories like EUCOMM

    • Crossing with FLP recombinase-expressing mice removes selection cassettes

    • Tissue-specific Cre expression drives targeted deletion

    • Breeding strategy recommendation: position floxed exon on one chromosome and either wild-type or fully deleted exon on the other to maximize recombination efficiency

  • Available Cre-driver Lines for Tissue-Specific Deletion:

    • B6.Cg-Tg(Gfap-cre)77.6Mvs/2J: Astrocyte-specific deletion

    • B6.129-Tg(Pcp2-Cre)2Mpin/J: Purkinje cell-specific deletion

    • B6.Cg-Tg(Plp1-cre/ERT)3Pop/J: Oligodendrocyte-specific deletion

    • B6.FVB(Cg)-Tg(Adora2a-cre)KG139Gsat/Mmucd: Medium spiny neuron-specific deletion

  • Verification Methods:

    • PCR genotyping to confirm genetic modifications

    • RT-PCR and Western blotting to verify altered expression

    • Immunohistochemistry to confirm cell-type specific deletion

    • Enzyme activity measurements to confirm functional consequences

    • For conditional knockouts, quantify colocalization of anti-Gnptab with cell-type specific markers (e.g., GFAP)

  • Zebrafish Models:

    • Morpholino knockdown or CRISPR/Cas9 editing in zebrafish

    • Faster generation time and higher throughput than mouse models

    • Transparent embryos facilitate imaging of developmental consequences

    • Useful for studying developmental aspects and for initial validation of mutations

What are the current challenges in developing therapeutic approaches for GNPTAB-related disorders?

Developing therapeutic approaches for GNPTAB-related disorders faces several significant challenges:

  • Biochemical Complexity:

    • GlcNAc-1-phosphotransferase is a complex heterohexameric enzyme (α₂β₂γ₂)

    • Requires proper assembly, trafficking, and proteolytic processing

    • Functions within the Golgi apparatus membrane system

    • Targets multiple different lysosomal hydrolases

  • Targeting Challenges:

    • Delivery of recombinant enzyme or gene therapy vectors to the Golgi apparatus

    • Need to cross cell membranes and reach specific intracellular compartments

    • Difficult to achieve sufficient enzyme levels across multiple tissues

    • Brain targeting particularly challenging due to blood-brain barrier

  • Disease Heterogeneity:

    • Different mutations cause distinct phenotypes (ML II, ML III, intermediate forms, stuttering)

    • Variable tissue involvement across patient populations

    • Some mutations affect enzyme activity, others affect trafficking or processing

    • Different therapeutic approaches may be needed for different mutation types

  • Timing Considerations:

    • Early developmental effects in severe forms (ML II)

    • Need to initiate therapy before irreversible damage occurs

    • Developmental disorders like stuttering may have critical early windows for intervention

  • Cell-Type Specific Pathology:

    • Recent evidence suggests cell-type specific effects (e.g., astrocyte involvement in stuttering)

    • May require targeted therapies for specific cell populations

    • Conditional knockout models show that different cell populations contribute to different aspects of pathology

  • Therapeutic Strategy Options:

    • Enzyme Replacement Therapy (ERT): Challenging due to need for intracellular delivery to Golgi

    • Gene Therapy: Packaging constraints for the large GNPTAB gene (~3.8 kb coding sequence)

    • Small Molecule Approaches: Need to identify compounds that can enhance residual enzyme activity or correct trafficking defects

    • RNA-Based Therapies: Potential for targeted correction of specific mutations

Current research directions include:

  • Detailed structural characterization to enable rational drug design

  • Cell-type specific delivery systems

  • Development of animal models that better recapitulate human disease

  • Investigation of non-canonical functions of GNPTAB in specific tissues

How should researchers interpret genotype-phenotype correlations in GNPTAB-related disorders?

Interpreting genotype-phenotype correlations in GNPTAB-related disorders requires a multifaceted approach:

  • Categorization of Mutation Types:

    • Nonsense and Frameshift Mutations: Generally associated with ML II (severe phenotype)

    • Missense Mutations: Can cause ML III (milder phenotype), intermediate forms, or stuttering

    • Splicing Mutations: Variable effects depending on impact on transcript processing

    • Compound heterozygosity further complicates interpretation

  • Functional Domain Considerations:

    • N-terminal cytoplasmic domain mutations (e.g., K4Q) affect Golgi retention

    • DMAP domain mutations (e.g., K732N) affect lysosomal hydrolase recognition

    • Catalytic domain mutations (e.g., mutations affecting His956, Arg986, Asn1151) directly impact enzyme activity

    • Understanding the affected domain helps predict functional consequences

  • Residual Enzyme Activity Correlation:

    • <1% activity: ML II (severe)

    • 1-10% activity: ML III (moderate)

    • 7-12% activity: Intermediate ML II/III

    • Higher but still reduced activity: Associated with stuttering

    • This quantitative relationship provides a framework for phenotype prediction

  • Special Case: c.10A>C/p.K4Q Mutation:

    • Causes a distinct intermediate ML II/III phenotype

    • Physical and radiographic features similar to ML II

    • Psychomotor development and life expectancy similar to ML III α/β

    • Demonstrates that specific mutations can create consistent intermediate phenotypes

  • Tissue-Specific Effects:

    • Some mutations may have preferential effects on specific tissues

    • Stuttering mutations appear to particularly affect the corpus callosum and astrocytes

    • Consider brain vs. systemic manifestations separately

  • Methodological Approach to New Mutations:

    • Structural modeling to predict impact on protein function

    • In vitro expression and activity assays to measure functional consequences

    • Assessment of mannose-6-phosphate formation on lysosomal hydrolases

    • Cathepsin D sorting assays to evaluate lysosomal enzyme trafficking

  • Consideration of Modifier Genes:

    • Evidence suggests additional genetic factors may modify GNPTAB-related phenotypes

    • GNPTG variations may affect phenotype in patients with GNPTAB mutations

    • Whole-genome or whole-exome sequencing may identify relevant modifiers

By integrating these considerations, researchers can better predict disease severity, guide genetic counseling, and develop targeted therapeutic approaches for patients with GNPTAB mutations.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.