Recombinant Human N-acetyltransferase 14 (NAT14)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
NAT14; KLP1; Probable N-acetyltransferase 14; K562 cell-derived leucine-zipper-like protein 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-206
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
Target Protein Sequence
MAPSHLSVREMREDEKPLVLEMLKAGVKDTENRVALHALTRPPALLLLAAASSGLRFVLA SFALALLLPVFLAVAAVKLGLRARWGSLPPPGGLGGPWVAVRGSGDVCGVLALAPGTNAG DGARVTRLSVSRWHRRRGVGRRLLAFAEARARAWAGGMGEPRARLVVPVAVAAWGVGGML EGCGYQAEGGWGCLGYTLVREFSKDL
Uniprot No.

Target Background

Function
Probable acetyltransferase; may function as a transcription factor regulating coproporphyrinogen oxidase expression via binding to a promoter regulatory element.
Gene References Into Functions
  1. Studies show that NAT8L, unlike NAT14, catalyzes NAA synthesis from L-aspartate and acetyl-CoA. PMID: 19807691
Database Links

HGNC: 28918

KEGG: hsa:57106

UniGene: Hs.31854

Protein Families
Camello family
Subcellular Location
Membrane; Single-pass membrane protein.
Tissue Specificity
Expressed in K-562 and HeLa cell lines and in brain.

Q&A

What is Human N-acetyltransferase 14 (NAT14) and what is its primary function?

Human N-acetyltransferase 14 (NAT14) is a probable acetyltransferase that binds to the 5'-GGACTACAG-3' sequence of the coproporphyrinogen oxidase promoter. Its primary function appears to be transcriptional activation, as it is able to activate transcription of a reporter construct in vitro . Unlike the more extensively characterized NAT1 and NAT2 enzymes which primarily catalyze N-acetylation of aromatic amines and O-acetylation of N-hydroxy-arylamines, NAT14's specific acetylation targets and mechanisms are still being elucidated. Research indicates it likely plays a regulatory role in gene expression through its DNA-binding capability and acetyltransferase activity.

What are the common aliases and identifiers associated with NAT14?

NAT14 is known by several aliases in the scientific literature and databases:

  • K562 cell-derived leucine-zipper-like protein 1 (KLP1)

  • K562 cells-derived leucine zipper-like protein 1

  • K562 cells-derived leucine-zipper-like protein 1

  • N-acetyltransferase 14 (GCN5-related, putative)

  • Probable N-acetyltransferase 14

For database identification and research reference, NAT14 is associated with:

  • UniProt ID: Q8WUY8 (Human)

  • Entrez Gene ID: 57106 (Human)

  • Gene Aliases: KLP1; NAT14

How does NAT14 differ from other N-acetyltransferases like NAT1 and NAT2?

While NAT14 belongs to the N-acetyltransferase family, it differs significantly from the well-characterized NAT1 and NAT2 enzymes. The primary differences include:

  • Function and substrate specificity: NAT14 appears to be involved in transcriptional regulation through DNA binding , while NAT1 and NAT2 primarily metabolize aromatic amine carcinogens through N-acetylation and O-acetylation reactions .

  • Structural characteristics: NAT14 contains a leucine-zipper-like domain (as suggested by its KLP1 alias) , which is not characteristic of NAT1 and NAT2.

  • Expression patterns: NAT1 and NAT2 have well-documented tissue-specific expression patterns, with NAT1 being more widely expressed in extrahepatic tissues and NAT2 predominantly in the liver . NAT14's expression pattern requires further characterization.

  • Cofactor interactions: NAT1 and NAT2 show different affinities for acetyl coenzyme A (AcCoA), with NAT1 showing higher affinity . The cofactor requirements and affinities of NAT14 remain to be fully elucidated.

What is known about NAT14's DNA binding mechanism and transcriptional activation properties?

NAT14 has been shown to bind the specific DNA sequence 5'-GGACTACAG-3' in the coproporphyrinogen oxidase promoter . This sequence-specific DNA binding appears to be central to its function as a transcriptional activator. When studying NAT14's DNA binding properties, researchers should consider:

  • DNA-protein interaction assays: Electrophoretic mobility shift assays (EMSAs) or chromatin immunoprecipitation (ChIP) can be employed to confirm binding specificity and identify additional genomic targets.

  • Mutational analysis: Systematic mutation of the binding sequence can help identify crucial nucleotides for recognition and binding affinity.

  • Structural studies: Crystallographic or NMR studies of NAT14 in complex with its target DNA sequence would provide insights into the molecular basis of sequence recognition.

  • Reporter gene assays: As NAT14 has been shown to activate transcription of a reporter construct in vitro , luciferase or GFP reporter assays with the coproporphyrinogen oxidase promoter or synthetic promoters containing the binding sequence can elucidate the mechanisms of transcriptional activation.

What experimental systems are most suitable for studying NAT14 function?

When choosing experimental systems for NAT14 research, consider the following approaches based on successful studies with related N-acetyltransferases:

  • Bacterial expression systems: Escherichia coli expression systems have been successfully used for recombinant production of related N-acetyltransferases . For NAT14, similar approaches may be viable, particularly using strains optimized for human protein expression.

  • Yeast expression systems: Schizosaccharomyces pombe has proven valuable for studying human NAT1 and NAT2 , suggesting it may be suitable for NAT14 expression as well. Yeast systems offer eukaryotic post-translational modifications while maintaining relatively simple culture conditions.

  • Mammalian cell expression: Chinese hamster ovary (CHO) cells have been employed effectively for expressing human NAT1 and NAT2 . For NAT14, similar mammalian expression systems would be appropriate, especially when studying interactions with mammalian transcriptional machinery.

  • Cell-free transcription systems: To study the direct effects of NAT14 on transcription, in vitro transcription assays using purified components may provide mechanistic insights while minimizing cellular complexity.

How can researchers effectively measure NAT14 acetyltransferase activity?

Based on methodologies used for related N-acetyltransferases, the following approaches could be adapted for NAT14:

  • Spectrophotometric assays: Using synthetic acetyl-acceptor substrates that produce measurable chromogenic or fluorogenic products upon acetylation.

  • Radioactive assays: Employing [14C]- or [3H]-labeled acetyl-CoA to track acetyl transfer to potential substrates through scintillation counting or autoradiography.

  • HPLC-based assays: Separating and quantifying acetylated products from non-acetylated substrates using high-performance liquid chromatography.

  • LC-MS/MS methods: For highest sensitivity and specificity, liquid chromatography coupled with tandem mass spectrometry can identify and quantify acetylated products.

When designing these assays, researchers should consider:

  • The potential substrate specificity of NAT14, which may differ from NAT1 and NAT2

  • Appropriate buffer conditions, including pH optimization

  • The potential influence of divalent cations and other cofactors

  • Controls to distinguish enzymatic from non-enzymatic acetylation

How should researchers approach the experimental design for NAT14 studies?

When designing experiments involving NAT14, researchers should consider principles of optimal experimental design:

  • Sampling and subsetting strategies: For large-scale studies, consider principled design approaches for subsetting data rather than simple random sampling. This approach can maintain statistical power while reducing computational burden .

  • Sequential design approach: Implementation of sequential design methods allows for continuous learning and optimization of experimental parameters. As described by Drovandi et al., sequential Monte Carlo (SMC) algorithms can be employed to approximate target distributions as data are collected .

  • Utility-based design: Focus on maximizing the utility of each experiment for parameter estimation. This approach involves selecting designs that yield precise estimates of model parameters, which can be approximated via importance sampling .

  • Consideration of design space: Analyze the available design space carefully, as correlation structures in the data may affect the ability to achieve optimal designs. Visual inspection of design spaces, as demonstrated in Figure 3 of the reference article, can help identify potential limitations in data coverage .

What kinetic analyses are appropriate for characterizing NAT14 activity?

For thorough kinetic characterization of NAT14 enzymatic activity, researchers should:

  • Determine apparent Km values: Calculate Michaelis-Menten parameters using appropriate software like GraphPad Prism, similar to methods used for NAT1 and NAT2 studies . This provides insights into substrate affinity and enzyme efficiency.

  • Evaluate cofactor affinity: Study the affinity of NAT14 for its cofactor (likely acetyl-CoA) across a range of concentrations. For related enzymes NAT1 and NAT2, significant differences in AcCoA affinity have been observed .

  • Normalize activity measurements: Express enzymatic activity relative to immunoreactive protein levels to account for variations in expression levels between preparations .

  • Statistical analysis: Apply appropriate statistical tests (such as unpaired t-tests) to evaluate significant differences in kinetic parameters between experimental conditions .

What approaches can help resolve contradictory findings in NAT14 research?

When faced with contradictory findings in NAT14 research, consider these methodological approaches:

  • Multi-system validation: Express NAT14 in multiple systems (bacterial, yeast, and mammalian cells) to determine if observed differences are system-dependent, as demonstrated in studies of NAT1 and NAT2 .

  • Protein quantification standardization: Use consistent protein quantification methods (e.g., Bio-Rad assay) and normalize activity to immunoreactive protein levels to ensure comparable results across studies .

  • Substrate panel testing: Test activity across multiple potential substrates, as substrate specificity may explain apparent contradictions in activity levels.

  • Experimental design analysis: Apply principles of optimal experimental design to identify potential gaps or biases in experimental coverage that might explain contradictory results .

What statistical methods are appropriate for analyzing NAT14 expression data?

For robust statistical analysis of NAT14 expression data:

  • Model selection: Choose appropriate statistical models based on data characteristics. For parametric estimation, maximize likelihood or Bayesian posterior distributions .

  • Utility-based sampling: When working with large datasets, use utility-based approaches to select informative subsets rather than random sampling. This can significantly improve parameter estimation precision while reducing computational burden .

  • Information criteria: Evaluate models using determinants of observed information matrices as a measure of precision in parameter estimation . This approach was shown to be effective in simulation studies comparing designed versus random sampling approaches.

  • Visualization of design space: Create visualizations like those in Figure 3 from reference to identify potential coverage issues in experimental design that may affect statistical analysis.

How can researchers effectively compare NAT14 with other N-acetyltransferases?

When comparing NAT14 with other N-acetyltransferases such as NAT1 and NAT2:

  • Standardized expression systems: Use identical expression systems for comparative studies, as demonstrated in the NAT1/NAT2 comparison studies using E. coli, S. pombe, and CHO cells .

  • Comparative kinetic analysis: Generate comparative data tables similar to those used in NAT1/NAT2 studies to highlight differences in substrate specificity, cofactor affinity, and catalytic efficiency .

  • Structure-function analysis: Perform structural comparisons to identify conserved and divergent domains that may explain functional differences between NAT enzymes.

  • Substrate panel screening: Test a consistent panel of potential substrates across different NAT enzymes to establish specificity profiles.

What bioinformatic tools can enhance NAT14 research?

Several bioinformatic approaches can advance NAT14 research:

  • Sequence homology analysis: Compare NAT14 sequences across species to identify conserved domains and potential functional motifs.

  • Protein structure prediction: Use tools like AlphaFold or RoseTTAFold to generate structural models in the absence of crystallographic data.

  • Transcription factor binding site analysis: Identify potential genomic regions containing the NAT14 binding motif (5'-GGACTACAG-3') to predict additional regulatory targets .

  • Protein-protein interaction prediction: Use algorithms to predict potential interaction partners within transcriptional complexes.

  • Pathway enrichment analysis: Apply tools like GSEA or IPA to expression data to identify pathways potentially regulated by NAT14.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.