Recombinant Human N-arachidonyl glycine receptor (GPR18)

Shipped with Ice Packs
In Stock

Description

Immune Regulation

  • CD8+ T Cell Homeostasis: GPR18 is critical for maintaining KLRG1+ effector-memory CD8+ T cells, which are essential for pathogen defense and tumor immunity. Knockout mice show reduced KLRG1+ populations, suggesting intrinsic receptor dependency .

  • Inflammation Resolution: RvD2, a metabolite of docosahexaenoic acid (DHA), binds GPR18 to enhance macrophage phagocytosis of pathogens and apoptotic cells (EC<sub>50</sub> ~2.0 × 10<sup>−13</sup> M) .

Neuroprotection

  • In hippocampal slice cultures, NAGly reduces NMDA-induced neuronal damage via GPR18 and CB<sub>2</sub> receptor crosstalk .

  • GPR18 activation modulates microglial motility and astrocyte reactivity, though signaling pathways (e.g., Akt, MAPK) remain partially characterized .

Cancer and Metabolic Disease

  • Elevated GPR18 expression in prostate cancer correlates with apoptosis resistance. Knockdown increases caspase-1 and IL-6, inducing cell cycle arrest .

  • Fasting-induced NAGly suppresses Th1/Th17 cytokines in CD4+ T cells via GPR18 and mTORC1, suggesting therapeutic potential in obesity-related inflammation .

Ligand Interactions and Signaling

LigandActivityExperimental Evidence
RvD2Agonist (pro-resolving)Activates GPR18 at picomolar concentrations; enhances phagocytosis in macrophages .
NAGlyPartial agonist/Controversial activityNeuroprotective in vitro but lacks canonical GPCR signaling in neurons .
THCAntagonist targetPSB-CB-27 (IC<sub>50</sub>: 650 nM) blocks THC-induced GPR18 activation .

Therapeutic Potential

  • Mood/Pain Disorders: GPR18 agonists (e.g., PSB-KK-1415) reduce anxiety-like behavior and hyperalgesia in rodents, mirroring cannabinoid receptor effects .

  • Cancer Immunotherapy: Small-molecule agonists may expand KLRG1+ CD8+ T cells to enhance antitumor responses .

Controversies and Challenges

  • NAGly as an Agonist: While NAGly binds GPR18 in immune cells, studies in sympathetic neurons show no canonical Gα<sub>i/o</sub> coupling, suggesting non-classical pathways or ligand-receptor promiscuity .

  • Receptor Crosstalk: GPR18 interacts with CB<sub>2</sub> receptors, complicating pharmacological targeting .

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them in your order notes. We will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please contact your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle to the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. To prevent degradation, avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
Please note that the tag type is determined during production. If you have a specific tag type in mind, please inform us and we will prioritize developing the specified tag.
Synonyms
GPR18; GPCRW; N-arachidonyl glycine receptor; NAGly receptor; G-protein coupled receptor 18
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-331
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
Target Protein Sequence
MITLNNQDQPVPFNSSHPDEYKIAALVFYSCIFIIGLFVNITALWVFSCTTKKRTTVTIY MMNVALVDLIFIMTLPFRMFYYAKDEWPFGEYFCQILGALTVFYPSIALWLLAFISADRY MAIVQPKYAKELKNTCKAVLACVGVWIMTLTTTTPLLLLYKDPDKDSTPATCLKISDIIY LKAVNVLNLTRLTFFFLIPLFIMIGCYLVIIHNLLHGRTSKLKPKVKEKSIRIIITLLVQ VLVCFMPFHICFAFLMLGTGENSYNPWGAFTTFLMNLSTCLDVILYYIVSKQFQARVISV MLYRNYLRSMRRKSFRSGSLRSLSNINSEML
Uniprot No.

Target Background

Function
GPR18 serves as a receptor for the endocannabinoid N-arachidonyl glycine (NAGly). However, conflicting findings regarding the role of NAGly as an agonist have been reported. GPR18 can also be activated by plant-derived and synthetic cannabinoid agonists. The receptor's activity is mediated by G proteins, leading to the inhibition of adenylyl cyclase. GPR18 potentially contributes to the regulation of the immune system. It is crucial for maintaining the normal homeostasis of CD8+ subsets of intraepithelial lymphocytes (IELs) (CD8alphaalpha and CD8alphabeta IELs) in the small intestine. This is achieved by supporting the preferential migration of CD8alphaalpha T-cells to the intraepithelial compartment over the lamina propria compartment and by facilitating their reconstitution into the small intestine following bone marrow transplant. GPR18 plays a role in hypotensive responses, mediating reductions in intraocular and blood pressure. It also mediates NAGly-induced reorganization of actin filaments and induction of acrosomal exocytosis.
Gene References Into Functions
  1. Results indicate that G protein-coupled receptor 18 (GPR18) might be involved in physiological processes of spermatozoa, suggesting GPR18 as a potential factor in sperm physiology. PMID: 27572937
  2. A novel RvD2-GPR18 resolution axis stimulates human and mouse phagocyte functions to control bacterial infections and promote organ protection. PMID: 26195725
  3. The findings presented herein provide further evidence for GPR18 as a potential cannabinoid receptor. PMID: 24762058
  4. GPR18, the most abundantly overexpressed orphan G-protein-coupled receptor in all melanoma metastases, is constitutively active and inhibits apoptosis, indicating a significant role for GPR18 in tumor cell survival. PMID: 20880198
  5. N-arachidonylglycine is a natural ligand for GPR18. PMID: 16844083

Show More

Hide All

Database Links

HGNC: 4472

OMIM: 602042

KEGG: hsa:2841

STRING: 9606.ENSP00000343428

UniGene: Hs.741589

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein. Cytoplasmic vesicle membrane.
Tissue Specificity
Expressed in midpiece of spermatozoon (at protein level). Most abundant in testis and spleen. Highly expressed in CD4 and CD8-positive T-cells as well as CD19-positive B-cells.

Q&A

What is GPR18 and what role does it play in biological systems?

GPR18 is an orphan G protein-coupled receptor that has been postulated to be a member of the cannabinoid receptor family. It is the subject of significant research interest for diverse therapeutic applications including regulation of intraocular pressure, cancer treatment, and immune system regulation . Recent studies have revealed that GPR18 contributes to the establishment of the intestinal CD8αα intraepithelial lymphocyte compartment, indicating its importance in maintaining mucosal immunity .

Methodologically, researchers investigating GPR18's biological role should consider both gain-of-function approaches (using recombinant expression systems) and loss-of-function approaches (using knockout models or RNA interference). GPR18 knockout mouse models have demonstrated a lower frequency of CD44hi CD62Llo effector-memory type CD8 T cells, suggesting the receptor's involvement in establishing or maintaining specific immune cell populations .

Where is GPR18 expressed in human and animal tissues?

GPR18 shows a distinctive tissue expression pattern that provides clues to its physiological functions. According to transcript analysis studies, GPR18 mRNA is present most abundantly in the testis, spleen, lymph nodes, and peripheral blood leukocytes . Particularly high expression has been identified in phytohaemagglutinin-activated CD4+ T-cells .

The receptor also shows considerable expression in CD8 T cells and slightly lower expression in CD4 T cells, with expression maintained in CD44hi memory phenotype cells . Notably, some cell lines previously reported to express GPR18, such as the mouse microglial BV-2 cell line and human endometrial HEC-1b cell line, have been found in some studies to lack detectable GPR18 mRNA .

For researchers conducting expression studies, it is recommended to:

  • Use RT-PCR with appropriate positive controls for initial screening

  • Confirm protein expression using validated antibodies

  • Consider single-cell RNA sequencing to identify specific cell populations expressing GPR18 within heterogeneous tissues

What is known about potential endogenous ligands for GPR18?

N-arachidonoyl glycine (NAGly) has been identified as a putative endogenous ligand for GPR18. This identification came from screening a bioactive lipid library against polyclonal L929 cells stably expressing human GPR18 or mock transfected, and measuring intracellular calcium flux. NAGly at 10 μM was identified as a hit in this screen .

Methodologically, when testing potential ligands for GPR18:

  • Multiple functional assays should be employed (calcium flux, ERK phosphorylation, cAMP modulation)

  • Dose-response relationships should be established

  • Both positive and negative controls should be included

  • Specificity should be confirmed using knockout models or RNA interference

What methodologies are most effective for enhancing GPR18 expression in recombinant systems?

Researchers have encountered challenges with GPR18 expression and detection in recombinant systems. To enhance GPR18 expression, one effective approach involves creating an amino terminal-tagged version with a signal sequence. Specifically, a 3HA amino terminal-tagged version of human GPR18 in pcDNATM 5/FRT with a 5′ bovine pre-prolactin signal sequence (pplss) has proven effective .

The 30 amino-acid signal sequence is recognized by the signal recognition particle, which increases nascent protein translocation across the endoplasmic reticulum membrane and significantly improves secretion efficiency. This signal peptide is cleaved prior to surface expression, as is typical for signal peptides .

Implementation recommendations:

  • Replace the original HA sequence with the pplss-3HA fragment at the 5′ end of the coding region

  • Increase the number of HA-tags from one to three to enhance staining intensity

  • Use standard DNA cloning methods for construct generation

  • Validate surface expression using confocal microscopy or flow cytometry

How can researchers effectively model GPR18 structure for drug discovery purposes?

Obtaining reliable structural models of GPR18 is crucial for understanding its function and for rational drug design. Various contemporary protein structure prediction methods have been employed, including both template-based and template-free modeling approaches .

The goal for creating a homology model of the GPR18 receptor should be to achieve a structure in the inactive state that meets all requirements for protein structure quality and can reliably recognize active ligands in virtual screening assays . Recent advances using the AlphaFold2 algorithm have provided new opportunities for generating high-quality GPCR structural models.

When developing structural models of GPR18, researchers should:

  • Compare multiple methods (template-based vs. template-free modeling)

  • Validate models using geometric and energy optimization processes

  • Assess models using both numerical estimates and functional assays

  • Consider the membrane environment in structural refinement

  • Validate models by their ability to identify known ligands in virtual screening

What is the role of GPR18 in CD8+ T cell development and maintenance?

GPR18 plays a cell-intrinsic role in the normal accumulation of CD8 effector T cells, particularly in the KLRG1+ effector-memory (EM) cell population. This has been demonstrated through studies using GPR18 knockout mice, which showed a reduction in spontaneously forming KLRG1+ CD8 effector-memory cells .

Mixed bone marrow chimera experiments have established that this effect is cell-intrinsic. When CD45.1+ mice were reconstituted with both wild-type and GPR18-deficient bone marrow, a selective deficiency in GPR18 knockout EM cells was observed in both blood and spleen, with the effect being most prominent for KLRG1+ CD8 EM cells .

Cell PopulationWild-typeGPR18 KOStatistical Significance
CD8+ EM cellsNormalReducedp < 0.05
KLRG1+ CD8+ EMNormalMarkedly reducedp < 0.05
Granzyme B+ CD8+ EMNormalReducedp < 0.05
T-bet expression in KLRG1+ cellsNormalSlightly elevated (n.s.)Not significant

Interestingly, the requirement for GPR18 appears to vary depending on the induction conditions. In LCMV Armstrong infection models, no clear differences were detected in virus-induced EM cell populations between GPR18 knockout and control mice .

How can researchers distinguish between GPR18-specific and non-specific effects in functional assays?

Distinguishing between specific and non-specific effects is a critical challenge in GPR18 research. Several methodological approaches can help researchers address this challenge:

  • Use of appropriate controls: When testing the effects of putative GPR18 ligands like NAGly, include both positive controls (known GPCR ligands) and negative controls (structurally similar but inactive compounds).

  • Rescue experiments: As demonstrated in the literature, reconstituting GPR18 expression in knockout cells can provide strong evidence for receptor-specific effects. Researchers have shown that compared to mice reconstituted with GPR18 knockout bone marrow transduced with an empty vector, mice receiving GPR18 knockout bone marrow transduced with GPR18 showed a selective increase in transduced CD8 EM and KLRG1+ cells .

  • Dose-response studies: Establish complete dose-response relationships for putative ligands.

  • Receptor antagonists: Where available, use selective antagonists to block potential GPR18-mediated effects.

  • Multiple readouts: Assess multiple downstream signaling events rather than relying on a single readout.

What are the conflicting findings in GPR18 research and how might they be reconciled?

Several notable contradictions exist in the GPR18 research literature:

  • Endogenous expression in cell lines: While some reports suggest that the mouse microglial BV-2 cell line and human endometrial HEC-1b cell line express functional GPR18, screening by reverse-transcription PCR has failed to detect GPR18 mRNA in these cell lines . This discrepancy might be due to differences in cell culture conditions, passage number, or PCR sensitivity.

  • NAGly as an endogenous ligand: Although NAGly was initially identified as a putative endogenous ligand for GPR18, subsequent studies have not confirmed it to be a functional GPR18 agonist . This contradiction might be reconciled by considering differences in experimental systems, GPR18 expression levels, or the presence of additional cellular components necessary for NAGly-GPR18 signaling.

  • Role in immune responses: GPR18 knockout mice show deficiencies in endogenously forming KLRG1+ CD8 effector-memory cells but display normal responses to LCMV Armstrong infection . This suggests that GPR18's role may be context-dependent, possibly more important for responses to commensal microorganisms than to acute viral infections.

To reconcile these contradictions, researchers should:

  • Carefully document experimental conditions

  • Directly compare different assay systems within the same study

  • Consider cellular context and receptor expression levels

  • Investigate potential species differences in GPR18 function

What expression systems are optimal for recombinant GPR18 production?

The choice of expression system significantly impacts the yield and functionality of recombinant GPR18. Based on the literature, several expression systems have been utilized:

For optimal expression and functionality, researchers should consider:

  • Adding signal sequences to enhance membrane targeting

  • Using epitope tags (such as HA-tags) to facilitate detection

  • Optimizing codon usage for the expression system

  • Validating receptor functionality using known signaling pathways

What are the recommended storage conditions for recombinant GPR18 proteins?

For maintaining the stability and activity of recombinant GPR18 proteins, proper storage conditions are essential. Based on available information for recombinant bovine GPR18 protein :

  • Store the lyophilized powder at -20°C/-80°C upon receipt

  • Aliquoting is necessary for multiple use to avoid repeated freeze-thaw cycles

  • After reconstitution, working aliquots can be stored at 4°C for up to one week

  • For long-term storage, add 5-50% glycerol (final concentration) and store at -20°C/-80°C

  • The recommended storage buffer is Tris/PBS-based buffer containing 6% Trehalose, pH 8.0

  • When reconstituting, use deionized sterile water to a concentration of 0.1-1.0 mg/mL

Repeated freezing and thawing should be avoided as it can lead to protein denaturation and loss of activity .

What are the most promising therapeutic applications for GPR18 modulation?

Based on current understanding of GPR18 biology, several therapeutic applications show promise:

  • Immune system modulation: Given GPR18's role in CD8 T cell development, agonists might augment the size of the KLRG1+ effector CD8 T cell compartment, potentially beneficial during viral responses or in tumor immunotherapy .

  • Inflammatory bowel disease: GPR18 SNPs have been detected as being enriched in inflammatory bowel disease patients in genome-wide association studies, suggesting potential therapeutic relevance in this area .

  • Intraocular pressure regulation: GPR18 has been implicated in the regulation of intraocular pressure, suggesting potential applications in glaucoma treatment .

  • Cancer therapy: GPR18's expression pattern and potential immunomodulatory effects make it an interesting target for cancer immunotherapy approaches .

Future research should focus on developing specific agonists and antagonists for GPR18 and validating these therapeutic applications in appropriate disease models.

What novel techniques might advance our understanding of GPR18 biology?

Several emerging techniques hold promise for advancing GPR18 research:

  • CRISPR-Cas9 genome editing: For creating precise modifications in the GPR18 gene to study structure-function relationships.

  • Single-cell RNA sequencing: To identify specific cell populations expressing GPR18 and characterize how its expression changes under different conditions.

  • Advanced structural biology techniques: Cryo-EM and X-ray crystallography could provide high-resolution structures of GPR18 in different conformational states.

  • Biosensors: Development of GPR18-specific biosensors could enable real-time monitoring of receptor activation in living cells.

  • Proteomics approaches: To identify GPR18-interacting proteins and characterize signaling complexes.

  • In vivo imaging: To monitor GPR18-expressing cells in living organisms during immune responses.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.