Recombinant Human N-formyl peptide receptor 3 (FPR3)

Shipped with Ice Packs
In Stock

Description

Definition and Biological Context

N-Formyl Peptide Receptor 3 (FPR3) is a member of the formyl peptide receptor family (FPR1, FPR2, FPR3) that detects pathogen-associated molecular patterns (PAMPs) like bacterial N-formyl peptides . Unlike FPR1 and FPR2, FPR3 exhibits unique ligand preferences and constitutive phosphorylation, suggesting roles in immune modulation and decoy receptor functions .

Recombinant FPR3 refers to the receptor protein expressed in heterologous systems (e.g., E. coli) for experimental use. It retains structural and functional properties of native FPR3, enabling mechanistic studies .

Ligand Binding

  • Primary Ligands:

    • F2L: Acetylated peptide derived from heme-binding protein 1 .

    • Humanin: Neuroprotective peptide linked to Alzheimer’s disease .

    • Weak affinity for N-formyl peptides (e.g., fMMYALF) .

Signaling Pathways

FPR3 activates intracellular pathways via Gαi proteins, modulating:

  • Calcium mobilization .

  • MAPK/ERK and PI3K/Akt cascades .

  • Chemotaxis in monocytes and dendritic cells .

Unique Traits

  • Constitutive Phosphorylation: High basal phosphorylation promotes rapid internalization, potentially acting as a decoy receptor .

  • Subcellular Localization: Resides in intracellular vesicles under resting conditions, unlike plasma membrane-localized FPR1/FPR2 .

Immune Response Studies

Recombinant FPR3 facilitates investigations into:

  • Neutrophil and monocyte chemotaxis .

  • Crosstalk between FPR3 and other receptors (e.g., FPR2/ALX) .

Drug Discovery

  • Screening for anti-inflammatory compounds targeting FPR3 .

  • Humanin-based therapies for neurodegenerative diseases .

Ligand Specificity

  • FPR3 binds F2L with high affinity (EC₅₀ ~10 nM), inducing chemotaxis in monocytes .

  • Humanin activation reduces neuroinflammation, suggesting therapeutic potential .

Phosphorylation Dynamics

  • Basal Phosphorylation: Mediated by residues in transmembrane domains, independent of C-terminal sequences .

  • Agonist-Induced Changes: Minimal phosphorylation increase upon F2L binding, contrasting with FPR2 .

Comparative Analysis

FeatureFPR3FPR1/FPR2
Ligand PreferenceF2L, HumaninBroad (N-formyl peptides, lipoxins)
LocalizationIntracellular vesiclesPlasma membrane
PhosphorylationConstitutiveAgonist-dependent
FunctionDecoy receptor, immune modulationDirect inflammation mediation

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Note: While the tag type is determined during production, we can prioritize the development of a specified tag if you provide the requirement.
Synonyms
FPR3; FPRH1; FPRL2; N-formyl peptide receptor 3; FMLP-related receptor II; FMLP-R-II; Formyl peptide receptor-like 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-353
Protein Length
Full length protein
Species
Homo sapiens (Human)
Target Names
Target Protein Sequence
METNFSIPLNETEEVLPEPAGHTVLWIFSLLVHGVTFVFGVLGNGLVIWVAGFRMTRTVN TICYLNLALADFSFSAILPFRMVSVAMREKWPFGSFLCKLVHVMIDINLFVSVYLITIIA LDRCICVLHPAWAQNHRTMSLAKRVMTGLWIFTIVLTLPNFIFWTTISTTNGDTYCIFNF AFWGDTAVERLNVFITMAKVFLILHFIIGFSVPMSIITVCYGIIAAKIHRNHMIKSSRPL RVFAAVVASFFICWFPYELIGILMAVWLKEMLLNGKYKIILVLINPTSSLAFFNSCLNPI LYVFMGRNFQERLIRSLPTSLERALTEVPDSAQTSNTDTTSASPPEETELQAM
Uniprot No.

Target Background

Function
Recombinant Human N-formyl peptide receptor 3 (FPR3) is a low-affinity receptor for N-formyl-methionyl peptides, potent neutrophil chemoattractants. FMLP binding to FPR3 activates neutrophils via a G-protein coupled mechanism, triggering a phosphatidylinositol-calcium second messenger system. FPR3 also functions as a receptor for humanin.
Gene References Into Functions
  1. Cell-free production of properly folded and functional human FPR3 facilitates efficient generation of human FPRs (and other GPCRs) for structural and functional analysis. PMID: 23746112
  2. Alternative promoter use during primate evolution leads to transcriptional variations of FPR3. PMID: 21717223
  3. The F2L peptide, derived from heme-binding protein (HEBP)1 processing, activates FPR3, inducing recruitment of FPR3-expressing monocytes, macrophages, and mouse neutrophils. PMID: 21709160
  4. uPAR expression regulates adhesion and migration of CXCR4-expressing cells via a mechanism involving fMLP receptors and αv integrins. PMID: 20972812
  5. Human dendritic cells express functional FPRL2 throughout maturation, suggesting a role in regulating DC trafficking during antigen uptake, processing, and T-cell stimulation. PMID: 12223529
  6. FPRL2 activation inhibits lipopolysaccharide-induced dendritic cell maturation. PMID: 16002663
  7. F2L inhibits formyl peptide receptor (FPR) and FPRL1, suppressing intracellular calcium increases and superoxide generation induced by N-formyl-Met-Leu-Phe, MMK-1, or Trp-Lys-Tyr-Met-Val-d-Met in neutrophils. PMID: 17577578
  8. FPRL2 is expressed and functional in in vitro differentiated macrophages under various conditions. PMID: 19342677
  9. Human monocytes express FPR1, FPR2, and FPR3; human neutrophils express FPR1 and FPR2, but not FPR3. PMID: 19843937
Database Links

HGNC: 3828

OMIM: 136539

KEGG: hsa:2359

STRING: 9606.ENSP00000341821

UniGene: Hs.445466

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Detected in various tissues with highest expression in lung.

Q&A

Advanced Research Questions

  • What are the optimal protocols for producing and purifying recombinant human FPR3 protein?

    Production of functional recombinant human FPR3 presents significant challenges due to its nature as a seven-transmembrane G protein-coupled receptor. Based on structural characteristics and expression patterns, researchers should consider the following methodological approach:

    1. Expression System Selection: Mammalian expression systems (HEK293 or CHO cells) are recommended over bacterial systems to ensure proper folding and post-translational modifications of FPR3.

    2. Vector Design: Incorporate purification tags (His, FLAG, or Fc) at either the N- or C-terminus, being mindful that the location may affect receptor functionality. Include a cleavable signal peptide to enhance membrane localization.

    3. Solubilization Strategy:

      DetergentConcentrationAdvantagesLimitations
      DDM0.5-1%Mild, maintains protein structureMay not fully solubilize
      LMNG0.01-0.1%High efficiency, stabilityExpensive
      Digitonin0.5-1%Preserves protein-protein interactionsBatch variability
      SMA copolymers2.5%Extracts native lipid environmentLimited compatibility with downstream applications
    4. Purification Protocol: Implement a two-step purification process using affinity chromatography followed by size exclusion chromatography. For functional studies, consider reconstitution into nanodiscs or liposomes to maintain native-like membrane environment.

    5. Quality Control: Verify structural integrity through circular dichroism spectroscopy and thermal stability assays. Functional validation should include ligand binding assays using known FPR3 agonists.

    The human FPR3 sequence (UniProt ID: P25089) should be used as reference: METNFSIPLNETEEVLPEPAGHTVLWIFSLLVHGVTFVFGVLGNGLVIWVAGFRMTRTVNTICYLNLALADFSFSAILPFRMVSVAMREKWPFGSFLCKLVHVMIDINLFVSVYLITIIAALDRCICVLHPAWAQNHRTMSLAKRVMTGLWIFTIVLTLPNFIFWTTISTTNGDTYCIFNFAFWGDTAVERLNVFITMAKVFLILHFIIGFSVPMSIITVCYGIIAAKIHRNHMIKSSRPLRVFAAVVASFFICWFPYELIGILMAVWLKEMLLNGKYKIILVLINPTSSLAFFNSCLNPILYVFMGRNFQERLIRSLPTSLERALTEVPDSAQTSNTDTTSASPPEETELQAM .

  • How can researchers effectively assess FPR3 receptor activity in experimental settings?

    Evaluating FPR3 activity requires specialized approaches due to its role in complex signaling networks. Researchers should implement a multi-parameter assessment strategy:

    1. Ligand Binding Assays: Though challenging due to FPR3's low affinity for classical formyl peptides, researchers can utilize fluorescently labeled N-formyl-methionyl peptides with high-sensitivity detection systems. Competition binding assays with known FPR3 ligands, including humanin, can provide valuable affinity data .

    2. Functional Signaling Assays:

      • Calcium mobilization assays using fluorescent calcium indicators (Fluo-4, Fura-2)

      • BRET/FRET-based G protein activation assays to monitor conformational changes

      • Phosphorylation analysis of downstream effectors (ERK1/2, Akt) by western blotting

      • Reporter gene assays for transcriptional responses

    3. Cellular Response Measurements:

      • Chemotaxis assays to evaluate cell migration in response to FPR3 activation

      • ROS production assessment using luminol-based chemiluminescence

      • Phagocytosis efficiency using fluorescently labeled particles

    4. Specificity Controls: Implement parallel assays with selective antagonists and in cells expressing FPR1 or FPR2 but not FPR3 to confirm specificity of observed responses.

    5. Advanced Techniques: Consider label-free technologies such as surface plasmon resonance (SPR) or biolayer interferometry (BLI) for real-time interaction analysis, and CRISPR-Cas9 gene editing to generate FPR3-knockout cells as negative controls.

    When interpreting results, researchers should account for potential cross-reactivity with other FPR family members due to their high sequence homology .

  • What is the significance of FPR3 as a biomarker in cancer, particularly breast cancer?

    FPR3 has emerged as a unique biomarker with significant prognostic value in cancer research. Comprehensive bioinformatic analysis has identified FPR3 as the sole immune-related factor that predicts poor prognosis in breast cancer . Several key findings support its significance:

    1. Expression Profile: FPR3 is highly expressed in multiple cancer types, including breast cancer subtypes, colorectal cancer, and head and neck squamous cell carcinoma. Both Oncomine and GEPIA databases confirm significantly higher FPR3 expression in breast cancer compared to adjacent normal tissue .

    2. Prognostic Value: Kaplan-Meier survival analysis from both TCGA and GEO datasets consistently demonstrates that high FPR3 expression correlates with worse patient outcomes. Cox regression analysis identified FPR3 as an independent prognostic factor with a hazard ratio >1 (p<0.0298), which is more significant than other immune checkpoints .

    3. Pathway Analysis: GSEA reveals that high FPR3 expression synergizes with activation of carcinogenesis-associated pathways. The most enriched pathways in high FPR3-expressing tumors are "pathways in cancer" and "cytokine-cytokine receptor interaction" .

    4. Correlation Network: FPR3 expression strongly correlates with PIK3R5, SPI1, and CSF1R in cancer pathways, and with CCR1, IL10, and IL10RA in cytokine signaling pathways. These associations suggest FPR3 may promote tumorigenesis through G-protein coupled receptor activation involving PI3K-AKT and MAPK signaling .

    For researchers investigating FPR3 as a cancer biomarker, a multi-platform validation approach is recommended, combining tissue microarray analysis, single-cell RNA sequencing of tumor immune microenvironments, and functional studies in patient-derived xenograft models.

  • What methodological approaches are most effective for studying FPR3 in immune cell function?

    Given FPR3's expression in phagocytic leukocytes and its role in immune responses, specialized methodological approaches are required:

    1. Cell Isolation and Culture:

      • Isolate primary monocytes, macrophages, and dendritic cells using magnetic separation or flow cytometry-based sorting

      • Generate monocyte-derived macrophages and dendritic cells through cytokine-directed differentiation

      • Consider tissue-resident macrophage isolation techniques for studying FPR3 in tissue-specific contexts

    2. Functional Assays:

      AssayMeasurementTechnical Considerations
      ChemotaxisCell migrationUse Transwell or Dunn chamber assays with gradient validation
      PhagocytosisParticle uptakeFluorescently labeled bacteria or zymosan particles with confocal microscopy
      Oxidative BurstROS productionLuminol-enhanced chemiluminescence or fluorescent probes (DCF-DA)
      Inflammasome ActivationIL-1β secretionELISA or multiplex cytokine analysis
      NFκB ActivationNuclear translocationImmunofluorescence or reporter gene assays
    3. Gene Modulation Strategies:

      • siRNA or shRNA for transient or stable FPR3 knockdown

      • CRISPR-Cas9 for complete FPR3 knockout

      • Overexpression systems with inducible promoters

    4. In vivo Models:

      • Humanized mouse models for studying human FPR3 in physiological contexts

      • Tissue-specific conditional knockout strategies

      • Adoptive transfer experiments to study FPR3-deficient immune cells in wild-type environments

    5. Single-Cell Analysis:

      • Flow cytometry for cellular phenotyping in conjunction with FPR3 expression

      • Single-cell RNA-seq to identify FPR3+ cell populations and their transcriptional profiles

      • Mass cytometry (CyTOF) for high-dimensional analysis of FPR3 in immune cell subsets

    When designing these experiments, researchers should carefully consider the differential expression of FPR3 across immune cell subsets and activation states, as well as potential compensatory mechanisms by other FPR family members .

  • How can researchers effectively target FPR3 for therapeutic development?

    Based on FPR3's role in immune regulation and cancer progression, several targeting strategies show promise for therapeutic development:

    1. Small Molecule Antagonists:

      • Design selective antagonists based on structure-activity relationships of known FPR ligands

      • Implement high-throughput screening of chemical libraries using calcium mobilization or β-arrestin recruitment assays

      • Optimize lead compounds for selectivity against FPR1 and FPR2 to minimize off-target effects

    2. Biologics Development:

      • Generate and screen monoclonal antibodies against extracellular domains of FPR3

      • Develop FPR3-targeting aptamers with potentially favorable tissue penetration

      • Explore peptide-based antagonists derived from known interacting partners

    3. Gene Therapy Approaches:

      • Design siRNA or antisense oligonucleotides targeting FPR3 mRNA

      • Investigate CRISPR-Cas9 delivery systems for tissue-specific FPR3 gene editing

      • Explore miRNA-based approaches to modulate FPR3 expression

    4. Combination Strategies:

      • Target FPR3 alongside PI3K pathway inhibitors, given the correlation with PIK3R5

      • Combine with immunotherapy approaches, particularly in breast cancer where FPR3 predicts poor prognosis

      • Incorporate FPR3 targeting with cytokine modulators, especially IL-10 pathway components

    5. Biomarker Integration:

      • Develop companion diagnostics for FPR3 expression to identify patients most likely to benefit

      • Establish monitoring protocols for FPR3 expression during treatment to evaluate therapeutic response

    In breast cancer specifically, where FPR3 has been identified as a unique negative prognostic factor among immune-related genes, inhibiting FPR3 expression or function may represent a promising intervention strategy . Researchers should focus on understanding the mechanism by which FPR3 promotes carcinogenesis through putative GPCR-coupled PI3K or MAPK signaling cascades to develop optimally targeted therapeutics .

  • What are the challenges in developing specific ligands for FPR3?

    Developing specific ligands for FPR3 presents several significant challenges that researchers must address:

    1. Structural Homology: The high sequence similarity between FPR family members (FPR3 shares 69% identity with FPR1 and 83% with FPR2) creates selectivity obstacles . Researchers must target unique structural features of FPR3 to achieve specificity.

    2. Binding Site Characterization: Unlike FPR1, whose binding site is well-characterized, FPR3's ligand binding domain remains incompletely defined. Computational approaches including homology modeling and molecular dynamics simulations should be employed to predict binding pocket configurations.

    3. Low Affinity Interactions: FPR3 displays low affinity for classical N-formyl peptides , making detection of binding events challenging. High-sensitivity assays with minimal background noise are essential.

    4. Orphan Receptor Status: Despite identification of humanin as a potential ligand , FPR3 remains partially characterized as an "orphan receptor" . Deorphanization strategies including ligand trapping and activity-based protein profiling should be considered.

    5. Assay Development Considerations:

      Assay ChallengeMitigation Strategy
      Signal-to-noise ratioUse amplification approaches (e.g., HTRF, AlphaScreen)
      Ligand specificity verificationParallel screening in FPR1/FPR2/FPR3 expressing cells
      Allosteric vs. orthosteric bindingEmploy radioligand displacement and functional assays
      Membrane protein environmentUtilize native-like lipid environments (nanodiscs, SMALPs)
    6. Screening Library Design: Focus on distinctive structural scaffolds by analyzing differences between known FPR1/FPR2 ligands. Consider fragment-based approaches to identify unique binding elements.

    To overcome these challenges, an integrated approach combining computational modeling, structural biology (including attempts at crystallography or cryo-EM), medicinal chemistry, and high-sensitivity functional assays would be most effective.

  • What experimental models are most appropriate for studying FPR3 function in disease contexts?

    Selecting appropriate experimental models is crucial for translational FPR3 research. Based on current knowledge of FPR3 biology and pathological roles, researchers should consider:

    1. Cellular Models:

      • Immune cell lines (THP-1, U937) with endogenous or engineered FPR3 expression

      • Primary human monocytes, macrophages, and dendritic cells

      • Cancer cell lines with differential FPR3 expression patterns

      • Co-culture systems combining immune and cancer cells to study microenvironmental interactions

    2. Organoid Models:

      • Patient-derived breast cancer organoids stratified by FPR3 expression levels

      • Immune-enhanced organoids incorporating FPR3-expressing leukocytes

      • Organoid co-culture systems to study cancer-immune cell interactions

    3. Animal Models:

      • Humanized mouse models expressing human FPR3

      • Xenograft models using FPR3-manipulated cancer cells

      • Syngeneic mouse models with orthotopic breast cancer focusing on immune infiltration

      • Genetically engineered models with conditional FPR3 expression in specific tissues

    4. Patient-Derived Xenografts (PDX):

      • PDX models from breast cancers with varying FPR3 expression levels

      • PDX models with humanized immune components to study FPR3 in immune-tumor interactions

    5. Disease-Specific Considerations:

      Disease ContextRecommended Model Features
      Breast CancerModels capturing different molecular subtypes with FPR3 expression profiling
      Inflammatory ConditionsModels with controllable inflammatory stimuli and FPR3-dependent readouts
      Infectious DiseasesBacterial challenge models assessing FPR3's role in host defense

    For breast cancer research specifically, models should be selected to reflect the correlation between high FPR3 expression and poor prognosis . Researchers should implement models that allow investigation of FPR3's interaction with PIK3R5, SPI1, CSF1R, CCR1, IL10, and IL10RA, as these have been identified as highly correlated with FPR3 expression in cancer contexts .

    Assessment of model validity should include verification of FPR3 expression patterns matching human disease, functional response to FPR3 modulation, and recapitulation of key pathway interactions identified through bioinformatic analyses.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.