Recombinant Human NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1 (NDUFA1)

Shipped with Ice Packs
In Stock

Description

Molecular Definition and Production

Recombinant Human NDUFA1 is a 70-amino-acid protein (8.1 kDa) expressed in Wheat germ systems, spanning residues 24–70 of the human protein . It is classified as an accessory subunit of mitochondrial Complex I (NADH:ubiquinone oxidoreductase), which transfers electrons from NADH to ubiquinone in the respiratory chain . Unlike core catalytic subunits, NDUFA1 is not directly involved in redox reactions but is essential for Complex I stability and activity .

PropertyDetails
Molecular Weight8.1 kDa
Amino Acid Range24–70
Expression SystemWheat germ
ApplicationsELISA, Western blot (WB)
Storage RecommendationsReconstitute in 5–50% glycerol for long-term storage at -20°C/-80°C

##Functional Role in Complex I
While NDUFA1 is non-catalytic, its absence abolishes Complex I activity. Key findings include:

  • Essential for enzyme assembly: Chinese hamster cell mutants lacking functional NDUFA1 exhibit <10% residual Complex I activity, restored via cDNA complementation .

  • Proton translocation: As part of the hydrophobic protein (HP) fraction, NDUFA1 may contribute to proton pumping across the mitochondrial membrane .

  • Interaction with FSP1: Binds ferroptosis suppressor protein 1 (FSP1), modulating coenzyme Q10 reduction and mitochondrial oxidative stress .

##Clinical and Pathological Significance
NDUFA1 mutations are linked to mitochondrial disorders:

  • Complex I deficiency (MT-C1D): Causes Leigh syndrome, cardiomyopathy, and neurodegenerative diseases .

  • G32R mutation: Reduces Complex I assembly and activity, correlating with muscle weakness and encephalopathy .

  • Cisplatin-induced nephrotoxicity: Hypermethylation of the NDUFA1 promoter exacerbates mitochondrial dysfunction and oxidative damage in renal tubular cells .

Research Applications

Recombinant NDUFA1 is widely used for:

  • Antibody validation: Serves as a positive control in WB and ELISA .

  • Functional studies: Investigates roles in electron transport, proton translocation, and disease mechanisms .

  • Therapeutic exploration: Overexpression mitigates cisplatin-induced cell death by preserving mitochondrial membrane potential and reducing ROS .

Recent Advances (2024)

A 2024 study revealed:

  • Epigenetic regulation: Hypermethylation of NDUFA1 in renal cells with IDH1 mutations increases sensitivity to cisplatin, highlighting its protective role against oxidative stress .

  • Therapeutic potential: NDUFA1 overexpression in proximal tubular cells reduces lipid peroxidation and mitochondrial ROS, suggesting strategies to counteract drug-induced nephrotoxicity .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have any specific format requirements, please indicate them when placing your order and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery timelines.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize its development.
Synonyms
NDUFA1; NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1; Complex I-MWFE; CI-MWFE; NADH-ubiquinone oxidoreductase MWFE subunit
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-70
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
Target Protein Sequence
MWFEILPGLSVMGVCLLIPGLATAYIHRFTNGGKEKRVAHFGYHWSLMERDRRISGVDRYYVSKGLENID
Uniprot No.

Target Background

Function
NDUFA1 is an accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I). It is believed to be non-catalytic, meaning it doesn't directly participate in the enzymatic reaction. Complex I plays a crucial role in transferring electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.
Gene References Into Functions
  1. Research on gene expression variability markers in early-stage human embryos indicates that NDUFA1 is a potential expression variability marker for the 3-day, 8-cell embryo stage. PMID: 26288249
  2. The gene signature of OPA1, CTSA, NDUFA1, STK10, and PRDX1 has the ability to identify patients post-implant with a sensitivity of 91% and a specificity of 86% in distinguishing between post-implant group and healthy controls. PMID: 27177495
  3. Fanconi anemia complementation group A mutants exhibit defective respiration through Complex I, diminished ATP production, and metabolic distress with an increased AMP/ATP ratio. PMID: 23791750
  4. A heterozygous mutation in the X chromosomal NDUFA1 gene has been identified in a girl with complex I deficiency. PMID: 21596602
  5. Mutations in the NDUFA1 gene are linked to a delayed mitochondrial network recovery in OXPHOS disorders. PMID: 20153825
  6. Species-specific and mutant MWFE proteins have an impact on the assembly of a functional mammalian mitochondrial complex I. PMID: 11937507
  7. A family-based association study suggests that the NDUFA1 gene is unlikely to be a major susceptibility locus for visual loss associated with Leber hereditary optic neuropathy. PMID: 12084895
  8. Oxidative stress and partial deficiencies of mitochondrial complex I are key factors in the pathogenesis of Parkinson's disease. (REVIEW) PMID: 15038604
  9. Suppression of NDUFA1 expression could represent a key pathogenic mechanism in the development of basal cell carcinoma. PMID: 15854127
  10. Two novel p.Gly8Arg and p.Arg37Ser hemizygous mutations in NDUFA1 were identified in two unrelated male patients presenting with Leigh's syndrome and with myoclonic epilepsy and developmental delay. PMID: 17262856
  11. The novel G32R mutation in NDUFA1 is hypothesized to cause complex I deficiency either independently or in conjunction with additional mtDNA variants. PMID: 19185523

Show More

Hide All

Database Links

HGNC: 7683

OMIM: 252010

KEGG: hsa:4694

STRING: 9606.ENSP00000360492

UniGene: Hs.534168

Involvement In Disease
Mitochondrial complex I deficiency (MT-C1D)
Protein Families
Complex I NDUFA1 subunit family
Subcellular Location
Mitochondrion inner membrane; Single-pass membrane protein; Matrix side.
Tissue Specificity
Primarily expressed in heart and skeletal muscle.

Q&A

What is NDUFA1 and what is its role in mitochondrial function?

NDUFA1, also referred to as the MWFE protein, is a 70-amino acid polypeptide that serves as an essential component of mitochondrial complex I (NADH-ubiquinone oxidoreductase). Despite being classified among the approximately 28 "accessory proteins" of complex I, experimental evidence demonstrates that NDUFA1 is absolutely essential for complex I activity in mammals . The protein is imported into mitochondria and associates with complex I without requiring proteolytic processing . Experimental studies with NDUFA1 mutants have demonstrated that its absence results in severe reduction of complex I activity (<10% of normal levels), establishing the critical nature of this polypeptide for functional complex I assembly and activity in mammalian systems .

What is the genetic structure of NDUFA1 and its evolutionary significance?

NDUFA1 is encoded by a relatively small gene (~5 kb) containing two introns (1.5 kb and 3 kb) that produces a 70-amino acid peptide . Notably, the NDUFA1 gene is located on the X chromosome, making it the only known X-linked complex I component identified so far . This X-chromosome linkage is largely conserved across mammals, providing a useful genetic marker for studying complex I disorders . From an evolutionary perspective, NDUFA1 represents an interesting case where an "accessory" protein that is not part of the core 14-subunit prokaryotic complex has become essential in more complex mammalian systems, highlighting the evolutionary adaptations in mitochondrial respiratory chain assembly.

How does NDUFA1 differ from other accessory subunits in complex I?

While NDUFA1 is classified as an accessory subunit, experimental evidence clearly distinguishes it from other accessory subunits like NDUFA6. Unlike NDUFA6, which is "believed to be not involved in catalysis" , NDUFA1 has been experimentally proven to be absolutely essential for complex I activity . Mutant cell lines with NDUFA1 defects show severely compromised complex I function, with activity reduced to less than 10% of normal levels . This contrasts with the presumed non-catalytic roles of many other accessory subunits. Additionally, the X-linked nature of NDUFA1 is unique among complex I components studied so far, suggesting distinctive evolutionary pressures on this particular subunit .

What are the most effective methods for studying NDUFA1 mutations?

Several complementary approaches have proven effective for investigating NDUFA1 mutations:

  • Cell-based complementation assays: The gold standard approach involves transfecting NDUFA1-deficient cells (e.g., CCL16-B2 mutant cells) with wild-type or mutant NDUFA1 cDNA and assessing restoration of complex I function . A comprehensive methodology includes:

    • Initial transfection and selection in standard glucose medium

    • Subsequent challenge in galactose medium (DMEM/Gal) to verify functional complementation

    • Verification through direct measurement of complex I activity

  • Complex I activity measurements: Direct assessment of NADH-dependent, rotenone-sensitive respiration using substrates like malate and glutamate that generate NADH within mitochondria .

  • Growth characterization: NDUFA1 mutants typically fail to grow in media with very low glucose or galactose, providing a straightforward phenotypic assessment .

These methods allow researchers to distinguish between complete loss-of-function mutations and partial defects that might retain some residual activity.

What expression systems are recommended for producing recombinant NDUFA1 protein?

For recombinant production of NDUFA1, prokaryotic expression systems have been successfully employed. Based on experimental approaches with similar complex I components:

  • E. coli expression system: Can be used for producing partial or complete NDUFA1 protein with appropriate tags (e.g., N-terminal GST tag) for purification and detection .

  • Expression construct considerations:

    ParameterRecommended Approach
    Host systemE. coli
    Vector typeTris-based buffer systems with glycerol stabilization
    Purification tagN-terminal tags preferable
    Protein solubilityMay require detergents for optimal solubilization
    Storage condition50% glycerol in appropriate buffer
  • Quality control: SDS-PAGE analysis is essential for verifying purity (target >90% purity) .

For applications requiring native conformation of NDUFA1, mammalian expression systems might be preferable, though yields may be lower.

How can researchers effectively analyze NDUFA1 incorporation into complex I?

Several complementary techniques are available for analyzing NDUFA1 incorporation into complex I:

  • Blue Native PAGE: Allows visualization of intact complex I and assembly intermediates containing NDUFA1.

  • Complexome profiling: This technique combines blue native PAGE with mass spectrometry to identify comigration of NDUFA1 with assembly intermediates and other complex I components .

  • Cryo-EM structural analysis: While not directly mentioned for NDUFA1 in the search results, this approach has been successfully applied to study assembly intermediates of complex I with associated factors .

  • Complementation assays: Transfection of NDUFA1-deficient cells with wild-type NDUFA1 cDNA followed by assessment of complex I assembly and activity provides functional confirmation of proper incorporation .

  • Respiration measurements: Direct measurement of rotenone-sensitive respiration provides functional evidence of successful NDUFA1 incorporation into active complex I .

What happens to complex I assembly in the absence of NDUFA1?

In the absence of functional NDUFA1, complex I assembly is severely compromised, with significant consequences:

  • Activity reduction: Complex I activity is reduced to less than 10% of normal levels in NDUFA1 mutant cells (CCL16-B2) .

  • Growth defects: NDUFA1-deficient cells cannot grow in media with low glucose or galactose, which force cells to rely on oxidative phosphorylation for ATP production .

  • Assembly pathway disruption: By analogy with studies on assembly factors like NDUFAF1, the absence of NDUFA1 likely prevents the formation of early assembly intermediates necessary for complex I biogenesis .

  • Module-specific effects: Drawing parallels from studies on assembly factors, NDUFA1 deficiency may specifically affect the assembly of particular modules of complex I while allowing others to form independently .

These observations collectively establish that NDUFA1 is not merely an accessory protein but an essential component for functional complex I assembly in mammals.

How does NDUFA1 contribute to mitochondrial disease pathogenesis?

The critical role of NDUFA1 in complex I function positions it as a potential contributor to mitochondrial disease:

  • X-linked inheritance pattern: As an X-linked gene, NDUFA1 mutations would be expected to show a male predominance in affected individuals, matching observations of "strong male preponderance" noted in some complex I deficiency cohorts .

  • Disease mechanisms: NDUFA1 mutations likely cause disease through:

    • Impaired complex I assembly and activity

    • Compromised NADH oxidation

    • Disrupted electron transport

    • Reduced ATP production

    • Potential increase in reactive oxygen species

  • Tissue-specific effects: The search results mention "highly variable expression of this gene in different tissues," suggesting that NDUFA1 mutations might affect tissues differentially based on their energy demands and expression levels .

  • Clinical relevance: While specific NDUFA1 mutations were not found in one cohort of 17 patients with suspected mitochondrial disease (14 male), the gene remains a candidate for X-linked mitochondrial disorders .

What is the relationship between NDUFA1 and complex I assembly factors?

The relationship between NDUFA1 and complex I assembly factors involves intricate interactions within the assembly pathway:

  • Assembly sequence relevance: By analogy with studies on assembly factor NDUFAF1, NDUFA1 likely plays a role in the early stages of complex I assembly .

  • Module-specific assembly: Research on assembly factors indicates that complex I assembly occurs in a modular fashion, with specific proteins required for assembling different modules (P-P module, P-D module, etc.) . NDUFA1 likely functions within this hierarchical assembly process.

  • Coordinated regulation: The absence of assembly factors like NDUFAF1 prevents formation of early assembly intermediates, suggesting coordinated regulation of subunit incorporation including NDUFA1 .

  • Evolutionary conservation: While some assembly factors show species-specific distribution (e.g., CIA84 found only in fungi), core components like NDUFA1 demonstrate broader conservation across species, indicating fundamental roles in complex I biology .

How can NDUFA1 mutants be used as tools for studying complex I assembly pathways?

NDUFA1 mutants provide valuable experimental platforms for investigating complex I assembly:

  • Null mutant advantages: Cell lines like CCL16-B2 with complete NDUFA1 deficiency allow researchers to:

    • Introduce modified complementing cDNAs to study specific mutations

    • Analyze assembly intermediates that accumulate in the absence of NDUFA1

    • Test the effects of mutations in other complex I components on a clean background

  • Assembly checkpoint identification: NDUFA1 mutants can help identify critical checkpoints in complex I assembly, as demonstrated by the observation that "null mutants like the CCL16-B2 mutant described here can be isolated, and it is expected that such null mutants will have useful applications in the study of other specific mutations" .

  • Rescue experiments: The ability to restore complex I function through complementation with wild-type NDUFA1 allows for precise structure-function studies through site-directed mutagenesis .

  • Comparative studies across species: NDUFA1 mutants from different species can help elucidate evolutionary adaptations in complex I assembly pathways.

What techniques can differentiate between primary NDUFA1 defects and secondary complex I abnormalities?

Distinguishing primary NDUFA1 defects from secondary complex I abnormalities requires a multi-faceted approach:

  • Genetic analysis: Direct sequencing of the NDUFA1 gene to identify mutations is the definitive approach for identifying primary defects.

  • Complementation studies: Introduction of wild-type NDUFA1 cDNA should restore complex I activity in cells with primary NDUFA1 defects but not in cells with defects in other components .

  • Module-specific assembly analysis: Based on studies of assembly factors, researchers can analyze the presence of specific modules (P-P, P-D, N, Q) to determine where in the assembly pathway the defect occurs .

  • Complexome profiling: This technique can reveal which assembly intermediates accumulate in the absence of functional NDUFA1, providing clues to the primary site of dysfunction .

  • Respiratory chain component analysis: Measurement of other respiratory chain complexes can help determine if the defect is specific to complex I (suggesting a primary NDUFA1 issue) or affects multiple complexes (suggesting a secondary mitochondrial dysfunction).

What are the theoretical considerations for developing therapeutic approaches for NDUFA1-related disorders?

Development of therapeutic approaches for NDUFA1-related disorders requires consideration of several factors:

  • Gene therapy potential: As a small gene (~5 kb) encoding a small protein (70 amino acids), NDUFA1 is theoretically amenable to gene therapy approaches .

  • Tissue-specific considerations: The variable expression of NDUFA1 across tissues suggests that therapeutic approaches may need to target specific tissues based on disease presentation .

  • Leaky mutations: Human patients with complex I deficiency due to nuclear mutations like NDUFA1 "must have leaky mutations to be viable," suggesting that even partial restoration of function could provide therapeutic benefit .

  • Potential approaches:

    Therapeutic StrategyTheoretical MechanismConsiderations
    Gene replacementIntroduction of functional NDUFA1 geneDelivery to affected tissues
    Bypass strategiesCircumventing complex I deficiencyMay not address all consequences
    Small molecule stabilizersEnhancing residual complex I functionRequires partial protein function
    Mitochondrial transplantationProvision of functional mitochondriaExperimental approach
  • Mouse model development: The creation of mouse models with NDUFA1 mutations could facilitate therapeutic testing, taking advantage of the X-linked nature of the gene for breeding strategies.

How might high-resolution structural studies advance our understanding of NDUFA1 function?

High-resolution structural studies offer promising avenues for deepening our understanding of NDUFA1:

  • Cryo-EM applications: Recent advances in cryo-EM have enabled visualization of complex I assembly intermediates with associated factors . Similar approaches could reveal:

    • The precise location of NDUFA1 within complex I

    • Conformational changes associated with NDUFA1 incorporation

    • Interaction interfaces with neighboring subunits

  • Structural consequences of mutations: Mapping disease-associated mutations onto high-resolution structures could provide mechanistic insights into dysfunction.

  • Assembly intermediate characterization: Structural studies of assembly intermediates that accumulate in NDUFA1-deficient cells could reveal the assembly pathway checkpoints.

  • Comparative structural biology: Comparisons between prokaryotic complex I (lacking NDUFA1) and eukaryotic complex I could highlight structural adaptations that necessitated NDUFA1 incorporation during evolution.

What is the relationship between NDUFA1 and other mitochondrial processes beyond oxidative phosphorylation?

The potential involvement of NDUFA1 in mitochondrial processes beyond its core role in complex I warrants investigation:

  • Mitochondrial dynamics: Complex I deficiency due to NDUFA1 mutations may impact mitochondrial fusion, fission, and motility.

  • Mitochondrial quality control: By analogy with assembly factor studies, NDUFA1 may interact with quality control systems that monitor complex I assembly .

  • Retrograde signaling: Complex I dysfunction due to NDUFA1 defects likely triggers retrograde signaling from mitochondria to the nucleus, affecting nuclear gene expression.

  • Interaction with other mitochondrial systems: The search results mention a surprising association between assembly factor NDUFAF1 and the transacylase tafazzin , suggesting unexpected connections between complex I assembly and other mitochondrial pathways. Similar connections might exist for NDUFA1.

  • Metabolic adaptation: Cells with NDUFA1 mutations must adapt their metabolism to compensate for complex I deficiency, potentially involving changes in substrate utilization and alternative energy production pathways.

How does tissue-specific expression of NDUFA1 influence phenotypic presentation of mutations?

The variable expression of NDUFA1 across tissues introduces important considerations for understanding disease manifestations:

  • Tissue vulnerability factors: The search results mention "highly variable expression of this gene in different tissues" , suggesting that tissues with higher NDUFA1 expression or greater dependence on complex I might be more affected by mutations.

  • Sex-specific effects: As an X-linked gene, NDUFA1 expression may be influenced by X-chromosome inactivation in females, potentially creating mosaic patterns of complex I dysfunction.

  • Developmental regulation: Changes in NDUFA1 expression during development could explain why some mitochondrial diseases have delayed onset or progressive phenotypes.

  • Research approaches:

    ApproachApplicationExpected Insight
    Tissue-specific expression profilingQuantify NDUFA1 levels across tissuesIdentify vulnerable tissues
    Conditional knockout modelsTissue-specific deletion of NDUFA1Determine tissue-specific requirements
    Patient tissue analysisCompare affected vs. unaffected tissuesCorrelate expression with pathology
    Single-cell sequencingAnalyze cellular heterogeneityIdentify vulnerable cell populations
  • Therapeutic implications: Understanding tissue-specific requirements for NDUFA1 could guide the development of targeted therapeutic approaches for specific disease manifestations.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.