Recombinant Human NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4 (NDUFB4)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
NDUFB4; NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4; Complex I-B15; CI-B15; NADH-ubiquinone oxidoreductase B15 subunit
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
2-129
Protein Length
Full Length of Mature Protein
Species
Homo sapiens (Human)
Target Names
Target Protein Sequence
SFPKYKPSSLRTLPETLDPAEYNISPETRRAQAERLAIRAQLKREYLLQYNDPNRRGLIE NPALLRWAYARTINVYPNFRPTPKNSLMGALCGFGPLIFIYYIIKTERDRKEKLIQEGKL DRTFHLSY
Uniprot No.

Target Background

Function

NDUFB4 is an accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I). It is not believed to be directly involved in catalysis. Complex I facilitates electron transfer from NADH to the respiratory chain, with ubiquinone considered the immediate electron acceptor.

Database Links

HGNC: 7699

OMIM: 603840

KEGG: hsa:4710

STRING: 9606.ENSP00000184266

UniGene: Hs.304613

Protein Families
Complex I NDUFB4 subunit family
Subcellular Location
Mitochondrion inner membrane; Single-pass membrane protein; Matrix side.

Q&A

What is the basic structure of NDUFB4 and where is it located in the cell?

NDUFB4 is a 15kDa protein consisting of 129 amino acids that functions as an accessory subunit of the mitochondrial electron transport chain complex I (NADH dehydrogenase) . The protein is encoded by the NDUFB4 gene, which is located on chromosome 3q13.33 and spans approximately 6,130 base pairs .

The protein exhibits a distinctive two-domain structure:

  • N-terminal hydrophobic domain that spans the inner mitochondrial membrane

  • C-terminal hydrophilic domain that interacts with the globular subunits of Complex I

This highly conserved structure suggests that NDUFB4 serves as an important anchor for the NADH dehydrogenase complex at the inner mitochondrial membrane .

What is the primary role of NDUFB4 in mitochondrial function?

While NDUFB4 is not directly involved in the catalytic activity of Complex I, it plays crucial structural roles:

  • It contributes to the assembly and stability of Complex I

  • It participates in the formation of respiratory supercomplexes, particularly the I₁III₂IV₁ respirasome

  • It contains specific residues (notably Asn24 and Arg30) that interact with the Complex III subunit UQCRC1 via hydrogen bonds

Complex I functions in transferring electrons from NADH to the respiratory chain, with ubiquinone serving as the immediate electron acceptor . NDUFB4's contribution to this process is structural rather than catalytic.

How do mutations in NDUFB4 affect mitochondrial respiratory function?

Research has demonstrated that specific point mutations in NDUFB4 have significant effects on respiratory function. When Asn24 and Arg30 residues are mutated to alanine (N24A, R30A), the following changes occur:

ParameterEffect in NDUFB4 Mutant (N24A, R30A) compared to RescuePercentage Change
Resting OCRDecreased-31%
Leak OCRDecreased-24%
Maximal OCRDecreased-40%
ATP-linked respirationDecreased-33%
CI-specific OXPHOSDecreasedSignificant
CII-specific OXPHOSIncreasedSignificant

These mutations impair respirasome assembly while minimally affecting Complex I integrity itself . This suggests that NDUFB4's role in supercomplex formation is distinct from its contribution to individual complex assembly.

What metabolic changes occur as a result of NDUFB4 dysfunction?

NDUFB4 dysfunction leads to significant metabolic reprogramming:

  • Cells with complete NDUFB4 knockout derive approximately 99% of ATP from glycolysis rather than oxidative phosphorylation

  • There is a global decrease in citric acid cycle metabolites, particularly affecting NADH-generating substrates

  • A metabolic shift occurs from Complex I-linked respiration toward Complex II-linked respiration

  • Increased lactate dehydrogenase (LDH) activity indicates greater reliance on glycolytic energy production

  • Enhanced malate dehydrogenase (MDH) activity suggests compensatory metabolic adaptations

These findings demonstrate that NDUFB4 is essential for maintaining normal oxidative metabolism, and its dysfunction forces cells to adopt alternative energy-producing pathways.

What are the most effective techniques for assessing NDUFB4's role in respirasome assembly?

Several complementary techniques have proven effective for investigating NDUFB4's role in respirasome formation:

  • Blue-native PAGE (BN-PAGE) with different detergent conditions:

    • Digitonin solubilization to preserve supercomplex interactions

    • Triton X-100 solubilization to assess individual complex integrity

  • Immunoblotting targeting specific complex subunits, such as:

    • NDUFA9 (Q module subunit) for Complex I

    • Other respiratory complex subunits to verify expression levels

  • Cellular respiration analysis using Seahorse XF technology to measure:

    • Basal respiration

    • ATP-linked respiration

    • Maximal respiratory capacity

    • Substrate-specific respiration (CI vs. CII)

  • Enzymatic activity assays for:

    • Citrate synthase (mitochondrial content)

    • Lactate dehydrogenase (glycolytic activity)

    • Malate dehydrogenase (TCA cycle function)

  • Metabolomic analysis to detect changes in cellular metabolites

These approaches allow researchers to distinguish between effects on Complex I assembly versus respirasome formation and determine the functional consequences of structural changes.

What expression systems are optimal for producing recombinant NDUFB4?

Based on commercial products and research protocols, Escherichia coli is the predominant expression system for recombinant human NDUFB4:

Expression SystemTagProtein RegionPurityBuffer CompositionApplications
E. coliHis-tag1-87 aa>90%20mM Tris-HCl (pH 8.0), 0.4M urea, 10% glycerolSDS-PAGE, Western blot

It's important to note that commercially available recombinant NDUFB4 is typically supplied in denatured form, which is suitable for applications like Western blotting but not ideal for functional studies . This reflects the challenges in maintaining membrane proteins in their native conformation outside their natural lipid environment.

How can researchers distinguish between direct effects of NDUFB4 mutations and secondary consequences?

Differentiating primary from secondary effects requires careful experimental design:

This multi-faceted approach helps attribute observed phenotypes to specific aspects of NDUFB4 function rather than general disruptions in mitochondrial structure or metabolism.

What are the implications of NDUFB4 research for understanding mitochondrial diseases?

While the direct clinical implications of NDUFB4 dysfunction haven't been fully established, research on related Complex I subunits provides relevant insights:

  • Mutations in the related subunit NDUFS4 are associated with Leigh syndrome, a severe neurodegenerative disorder

  • NDUFS4 has been studied in diabetic kidney disease models, where its overexpression improved cristae morphology and mitochondrial dynamics

  • High expression of NDUFS4 is associated with poor prognosis in gastric cancer, suggesting potential roles in tumor biology

Given NDUFB4's role in respirasome formation and the impact of its dysfunction on cellular bioenergetics, it likely contributes to pathologies involving mitochondrial dysfunction, including:

  • Neurodegenerative diseases

  • Metabolic disorders

  • Potentially certain cancers

Research on NDUFB4 and its interactions may reveal new therapeutic targets for disorders involving respiratory chain dysfunction.

What controls are essential when investigating NDUFB4 function in cellular models?

To ensure reliable and interpretable results, the following controls are crucial:

  • Expression level controls:

    • Quantification of NDUFB4 protein levels via Western blot

    • Verification that mutant and wild-type proteins are expressed at comparable levels

  • Complex integrity controls:

    • Assessment of Complex I assembly via BN-PAGE with Triton X-100

    • Verification that other respiratory complex subunits are expressed normally

  • Mitochondrial content controls:

    • Measurement of citrate synthase activity

    • Quantification of mitochondrial markers

  • Functional baselines:

    • Determination of basal respiration rates

    • Measurement of maximal respiratory capacity

    • Assessment of substrate-specific respiration

  • Genetic controls:

    • Complete knockout cells

    • Empty vector controls

    • Wild-type rescue controls

These controls help distinguish between effects due specifically to NDUFB4 alterations versus non-specific effects resulting from experimental manipulations.

How can researchers address the challenges of studying membrane-integrated proteins like NDUFB4?

Membrane proteins present unique experimental challenges that require specialized approaches:

  • Detergent selection is critical:

    • Mild detergents like digitonin preserve supercomplex interactions

    • Stronger detergents like Triton X-100 isolate individual complexes

  • Native vs. denatured analysis:

    • Native conditions are essential for functional studies

    • Denatured proteins may be suitable for immunodetection but not functional assays

  • Expression system considerations:

    • E. coli systems typically yield denatured protein

    • Mammalian expression systems might better preserve native conformation

    • In situ analysis in intact mitochondria may be preferable for certain applications

  • Functional assessment approaches:

    • In situ respirometry in permeabilized cells

    • Isolated mitochondria studies

    • Reconstitution in liposomes or nanodiscs for purified protein studies

  • Imaging techniques:

    • Immunofluorescence for localization studies

    • Super-resolution microscopy for detailed structural analysis

    • Electron microscopy for ultrastructural assessment

These specialized approaches help overcome the inherent challenges of studying membrane proteins while maintaining their structural and functional integrity.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.