Recombinant Human NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial (NDUFB5)

Shipped with Ice Packs
In Stock

Description

Functional Role in Mitochondrial Respiration

NDUFB5 is an accessory subunit of Complex I (NADH:ubiquinone oxidoreductase), which transfers electrons from NADH to ubiquinone in the electron transport chain . Key functional insights include:

  • Non-catalytic role: Stabilizes Complex I’s L-shaped structure but does not participate directly in redox reactions .

  • Mitochondrial respiration: Critical for maintaining oxidative phosphorylation efficiency. Knockdown impairs mitochondrial membrane potential and ATP production .

3.1. Septic Cardiomyopathy (SC)

NDUFB5 was identified as a hub gene in septic cardiomyopathy through weighted gene co-expression network analysis (WGCNA). Its downregulation correlates with mitochondrial dysfunction and cardiac injury .

3.2. Diabetic Wound Healing

In hyperglycemic conditions, NDUFB5 expression is modulated by METTL3-mediated m6A RNA methylation, enhancing mitochondrial respiration in endothelial cells. Overexpression improves cell viability and accelerates wound healing in diabetic mice .

Study ModelKey Findings
Lipopolysaccharide-induced sepsis (mouse)NDUFB5 mRNA levels decreased by 60%, exacerbating cardiac dysfunction .
AGEs-treated HUVECsNDUFB5 overexpression restored mitochondrial respiration by 45% .

Therapeutic Potential

NDUFB5 is under investigation as a biomarker and therapeutic target for:

  • Septic cardiomyopathy: Restoration of NDUFB5 levels improved cardiac output by 30% in preclinical models .

  • Diabetic foot ulcers (DFU): METTL3-NDUFB5 axis activation reduced endothelial cell apoptosis by 50% .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and agreed upon in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If a specific tag is required, please inform us, and we will prioritize its inclusion.
Synonyms
CI SGDH; CI-SGDH; Complex I SGDH; Complex I-SGDH; DKFZp686N02262; FLJ30597; MGC111204; MGC12314; mitochondrial; NADH dehydrogenase (ubiquinone) 1 beta subcomplex 5 ; NADH dehydrogenase (ubiquinone) 1 beta subcomplex 5 16kDa; NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5; NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5 mitochondrial; NADH ubiquinone oxidoreductase SGDH subunit; NADH-ubiquinone oxidoreductase SGDH subunit; NDUB5_HUMAN; Ndufb5; SGDH
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
47-189
Protein Length
Full Length of Mature Protein
Species
Homo sapiens (Human)
Target Names
Target Protein Sequence
SGDHGKRLFVIRPSRFYDRRFLKLLRFYIALTGIPVAIFITLVNVFIGQAELAEIPEGYVPEHWEYYKHPISRWIARNFYDSPEKIYERTMAVLQIEAEKAELRVKELEVRKLMHVRGDGPWYYYETIDKELIDHSPKATPDN
Uniprot No.

Target Background

Function
Recombinant Human NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial (NDUFB5) is an accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I). It is not believed to be directly involved in catalysis. Complex I facilitates electron transfer from NADH to the respiratory chain, with ubiquinone as the presumed immediate electron acceptor.
Gene References Into Functions
  1. Differential expression of this protein has been observed in the temporal lobe of schizophrenia patients. PMID: 19034380
Database Links

HGNC: 7700

OMIM: 603841

KEGG: hsa:4711

STRING: 9606.ENSP00000259037

UniGene: Hs.730674

Protein Families
Complex I NDUFB5 subunit family
Subcellular Location
Mitochondrion inner membrane; Single-pass membrane protein; Matrix side.

Q&A

What is the functional significance of NDUFB5 in mitochondrial respiration?

NDUFB5 functions as an accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I). While it is not directly involved in catalysis, NDUFB5 plays a crucial role in the transfer of electrons from NADH to the respiratory chain, with ubiquinone serving as the immediate electron acceptor . The protein contributes to maintaining mitochondrial respiration efficiency and energy production through oxidative phosphorylation .

Complex I, where NDUFB5 operates, initiates the electron transport chain by transferring electrons from NADH to ubiquinone, facilitating the generation of a proton gradient across the mitochondrial inner membrane that drives ATP synthesis . This process is essential for cellular energy production, particularly in tissues with high energy demands.

Recent studies demonstrate that NDUFB5 promotes cell viability, migration, and mitochondrial respiration in advanced glycation end products (AGEs)-treated human umbilical vein endothelial cells (HUVECs) . Knockdown of NDUFB5 compromises these cellular processes, which can be rescued through mitochondrial fusion promotion .

How is NDUFB5 structurally integrated within Complex I?

NDUFB5 is one of 45 different subunits that compose mammalian Complex I . It localizes specifically to the mitochondrial inner membrane . While not directly participating in the catalytic core, NDUFB5 is integral to the structural stability and functional efficiency of Complex I.

For researchers investigating NDUFB5 structure-function relationships, it's important to note that commercial recombinant proteins typically represent specific fragments of the full protein, such as amino acids 103-189, which may be used as control fragments in experimental settings .

What experimental approaches are most effective for studying NDUFB5 expression?

To study NDUFB5 expression, researchers can employ several complementary techniques:

  • Quantitative RT-PCR (qRT-PCR): For mRNA quantification, primer sequences such as:

    • NDUFB5-F: 5ʹ-TCCTGTTCGACACAGTGGAG-3ʹ

    • NDUFB5-R: 5ʹ-AGGACGGCCATTGTTCTTTCA-3ʹ
      have been validated for effective quantification .

  • Western Blot Analysis: Anti-NDUFB5 antibodies (e.g., ab230215) can be used at a dilution of 1/500 for detecting NDUFB5 protein in various tissue lysates, including heart, kidney, and cell lines like HEK-293T . The expected molecular weight is approximately 16 kDa.

  • Immunohistochemistry/Immunofluorescence: Anti-NDUFB5 antibodies suitable for IHC-P and ICC/IF applications allow for visualization of NDUFB5 localization within tissues and cells .

For reliable results, it's essential to include appropriate positive controls (tissues known to express NDUFB5, such as heart and kidney) and negative controls (samples with NDUFB5 knockdown or tissues with naturally low expression).

How does NDUFB5 contribute to diabetic wound healing mechanisms?

NDUFB5 plays a significant role in diabetic wound healing through several mechanisms:

  • Mitochondrial respiration support: Skin wound healing requires substantial energy, primarily provided through mitochondrial respiration via oxidative phosphorylation. NDUFB5, as a key component of Complex I, maintains efficient electron transport and energy production necessary for the healing process .

  • Endothelial cell function: Research demonstrates that NDUFB5 promotes viability and migration of endothelial cells treated with advanced glycation end products (AGEs), which are elevated in diabetic conditions . These cellular processes are essential for angiogenesis and vascular repair during wound healing.

  • In vivo evidence: Studies using diabetic mouse models have shown that adenovirus-mediated NDUFB5 overexpression (Ad-NDUFB5) at wound sites accelerates healing in streptozotocin (STZ)-induced diabetic mice . This supports NDUFB5's therapeutic potential in treating diabetic foot ulcers (DFU).

  • Counteracting AGEs effects: AGEs, which accumulate in diabetic conditions, impair endothelial cell function by inhibiting proliferation and migration while promoting apoptosis. NDUFB5 appears to counteract these detrimental effects, potentially by maintaining mitochondrial function .

For researchers investigating this pathway, experimental approaches might include combining NDUFB5 overexpression with mitochondrial function assessments in endothelial cells exposed to diabetic conditions, or examining wound closure rates in animal models with modulated NDUFB5 expression.

What is the role of m6A modification in regulating NDUFB5 expression?

The m6A (N6-methyladenosine) modification has emerged as a critical mechanism regulating NDUFB5 expression, particularly in the context of diabetic complications:

  • METTL3-mediated m6A modification: Methyltransferase-like 3 (METTL3) mediates m6A modification of NDUFB5 mRNA, enhancing its expression in human umbilical vein endothelial cells (HUVECs) . This epigenetic regulation appears to be particularly important under stress conditions such as exposure to advanced glycation end products (AGEs).

  • IGF2BP2 stabilization: Insulin-like growth factor 2 mRNA binding protein 2 (IGF2BP2) recognizes the m6A modification on NDUFB5 mRNA and stabilizes it, preventing degradation and allowing for increased protein expression . This represents a "writer-reader" mechanism of m6A regulation.

  • mRNA stability: Experimental evidence using actinomycin D treatment shows that m6A modification increases NDUFB5 mRNA stability, leading to prolonged half-life and increased protein production .

  • Functional significance: METTL3 overexpression promotes cell viability, migration, and mitochondrial respiration in AGEs-treated HUVECs through increasing NDUFB5 expression, establishing a METTL3-NDUFB5 axis in protecting against cellular injury .

For studying this regulatory mechanism, researchers should consider the following methodological approach:

  • RIP (RNA Immunoprecipitation) assays with anti-m6A and anti-IGF2BP2 antibodies to detect m6A modification and IGF2BP2 binding to NDUFB5 mRNA

  • Actinomycin D chase experiments to measure mRNA stability

  • Luciferase reporter assays with the 3'UTR of NDUFB5 to assess the functional impact of m6A modifications on expression

How can recombinant NDUFB5 be utilized in experimental blocking assays?

Recombinant NDUFB5 protein fragments serve as valuable tools in antibody validation and specificity testing through blocking experiments:

  • Optimal blocking protocol: For effective blocking experiments with anti-NDUFB5 antibodies (e.g., PA5-52172), researchers should use a 100x molar excess of the recombinant protein control fragment based on antibody concentration and molecular weight . This ensures sufficient binding to antibodies to prevent non-specific interactions.

  • Pre-incubation parameters: The antibody-protein control fragment mixture should be pre-incubated for 30 minutes at room temperature before application to samples . This allows complete formation of antibody-antigen complexes that prevent antibody binding to the target in subsequent applications.

  • Applications: Blocking experiments are particularly valuable for validating antibody specificity in immunohistochemistry/immunocytochemistry (IHC/ICC) and Western blot (WB) applications . A reduction in signal after pre-incubation with the recombinant fragment confirms antibody specificity.

  • Fragment selection: Commercial recombinant NDUFB5 fragments, such as the aa 103-189 region, are designed to contain key epitopes recognized by antibodies . When selecting a fragment, researchers should ensure it contains the antigenic regions targeted by their specific antibody.

When interpreting blocking experiment results, a significant reduction in signal (>80%) after pre-incubation with the specific fragment indicates high antibody specificity, while persistent signals suggest potential cross-reactivity with other proteins.

What are the optimal transfection approaches for NDUFB5 overexpression and knockdown studies?

Based on successful experimental protocols in NDUFB5 research, the following approaches have proven effective:

  • NDUFB5 Overexpression:

    • Plasmid-based approach: Cloning the NDUFB5 coding sequence into pcDNA3.1(+) plasmid vectors has been successfully employed for transient overexpression in cell culture models .

    • Transfection method: Lipofectamine 2000 has demonstrated good efficiency for introducing NDUFB5 expression vectors into human umbilical vein endothelial cells (HUVECs) .

    • In vivo delivery: Adenovirus vectors expressing NDUFB5 (Ad-NDUFB5) have been effectively used for targeted delivery to wound sites in diabetic mouse models, showing successful protein expression and functional effects .

  • NDUFB5 Knockdown:

    • siRNA approach: Synthetic small interfering RNAs (siRNAs) targeting NDUFB5 have been successfully used to achieve knockdown in cellular models .

    • Transfection efficiency: For optimal knockdown, standard transfection reagents like Lipofectamine 2000 can be employed following manufacturer's protocols .

    • Control selection: Using scramble siRNA (siNC) as negative control is essential for distinguishing specific effects of NDUFB5 knockdown from transfection-related artifacts .

  • Experimental validation:

    • Successful manipulation of NDUFB5 expression should be confirmed at both mRNA level using qRT-PCR and protein level using Western blot .

    • For functional studies, appropriate timing after transfection (typically 24-48 hours) is critical before challenging cells with experimental conditions such as AGEs treatment .

For researchers designing NDUFB5 manipulation experiments, it's advisable to optimize transfection conditions for their specific cell type, as efficiency may vary between different cellular models.

What methods are most reliable for assessing NDUFB5-related mitochondrial function?

To effectively evaluate how NDUFB5 affects mitochondrial function, researchers should consider these methodological approaches:

  • Mitochondrial Respiration Analysis:

    • Oxygen consumption rate (OCR) measurement using platforms like Seahorse XF analyzer can directly assess the impact of NDUFB5 manipulation on mitochondrial respiratory capacity

    • Key parameters to measure include basal respiration, ATP production, maximal respiration, and spare respiratory capacity

    • Comparison between NDUFB5-overexpressing, NDUFB5-knockdown, and control cells provides functional insights into its role in electron transport chain efficiency

  • Mitochondrial Membrane Potential Assessment:

    • Fluorescent probes such as TMRM (tetramethylrhodamine methyl ester) or JC-1 can evaluate changes in mitochondrial membrane potential resulting from NDUFB5 alterations

    • Flow cytometry or fluorescence microscopy can quantify these changes at cellular and subcellular levels

  • ATP Production Measurement:

    • Luminescence-based ATP assays can directly quantify how NDUFB5 manipulation affects cellular energy production

    • Comparing ATP levels under different metabolic conditions (glucose vs. galactose media) can specifically highlight NDUFB5's contribution to oxidative phosphorylation

  • Rescue Experiments:

    • Using mitochondrial fusion promoters (e.g., M1) in NDUFB5 knockdown cells can help establish the specificity of observed mitochondrial defects

    • These experiments are particularly valuable for distinguishing between direct effects of NDUFB5 deficiency and compensatory mechanisms

  • ROS Production Analysis:

    • Measuring reactive oxygen species using probes like MitoSOX can evaluate whether NDUFB5 alterations affect electron leakage from Complex I

    • This approach provides insights into potential oxidative stress resulting from NDUFB5 dysfunction

When designing these experiments, researchers should include appropriate positive controls (such as known Complex I inhibitors like rotenone) and negative controls to validate assay sensitivity and specificity.

How should researchers interpret changes in NDUFB5 expression across different tissue types?

Interpreting tissue-specific variations in NDUFB5 expression requires careful consideration of several factors:

  • Baseline Expression Patterns:

    • NDUFB5 is expressed in multiple tissues, with evidence of detection in heart, kidney, and various cell lines including HEK-293T

    • Expression levels naturally vary between tissues based on mitochondrial content and energy demands

    • Researchers should establish normal baseline expression in their tissues of interest before interpreting disease-related changes

  • Analytical Considerations:

    • When comparing NDUFB5 expression across tissues, normalization to appropriate housekeeping genes or proteins is critical for accurate quantification

    • For Western blot analysis, a dilution of 1/500 for anti-NDUFB5 antibodies has been validated for detecting the protein in multiple tissue types

    • The expected molecular weight of approximately 16 kDa should be confirmed to ensure specific detection

  • Physiological Significance:

    • Higher NDUFB5 expression in tissues with greater energy demands (e.g., heart) reflects its importance in maintaining efficient mitochondrial respiration

    • Reduced expression in diabetic contexts, such as in skeletal muscle, correlates with altered metabolism

    • Experimental evidence shows downregulation in conditions with mitochondrial dysfunction, suggesting potential compensatory responses

  • Pathological Contexts:

    • In diabetic conditions, NDUFB5 expression changes have been linked to carbohydrate, energy, and amino acid metabolism alterations

    • Therapeutic upregulation of NDUFB5 accelerates diabetic wound healing, indicating functional significance of expression changes

    • Researchers should consider whether expression changes represent causal factors or compensatory responses in pathological states

When publishing findings on NDUFB5 expression patterns, researchers should include detailed methodological information and appropriate controls to facilitate interpretation and reproducibility across different experimental systems.

How does post-transcriptional regulation influence NDUFB5 function in cellular stress responses?

NDUFB5 undergoes sophisticated post-transcriptional regulation that significantly impacts its expression and function during cellular stress:

  • m6A RNA Modification:

    • The m6A modification on NDUFB5 mRNA represents a critical regulatory mechanism mediating its response to stress conditions

    • METTL3, a methyltransferase that catalyzes m6A addition, enhances NDUFB5 expression in human umbilical vein endothelial cells (HUVECs) exposed to advanced glycation end products (AGEs)

    • This modification occurs specifically in the 3' untranslated region (UTR) of NDUFB5 mRNA, as demonstrated through RIP assays with anti-m6A antibodies

  • RNA-Binding Protein Interactions:

    • IGF2BP2 (insulin-like growth factor 2 mRNA binding protein 2) specifically recognizes and binds to m6A-modified NDUFB5 mRNA

    • This interaction stabilizes the transcript, preventing degradation and extending its half-life under stress conditions

    • Actinomycin D chase experiments have confirmed increased NDUFB5 mRNA stability resulting from this regulatory mechanism

  • Translational Efficiency:

    • The m6A modification and subsequent IGF2BP2 binding enhance translational efficiency of NDUFB5 mRNA

    • Luciferase reporter assays with the NDUFB5 3'UTR provide experimental evidence for this enhanced expression

    • The increased translation contributes to higher protein levels needed to maintain mitochondrial function during cellular stress

  • Functional Consequences:

    • This regulatory axis (METTL3 → m6A modification → IGF2BP2 binding → NDUFB5 upregulation) promotes cell viability, migration, and mitochondrial respiration under stress conditions

    • Disruption of this pathway impairs cellular responses to stressors like AGEs, highlighting its importance in adaptation to adverse conditions

For researchers investigating this regulatory mechanism, experimental approaches should include RIP-qPCR, mRNA stability assays, and reporter gene studies with wild-type and mutated 3'UTR sequences to fully characterize the post-transcriptional regulation of NDUFB5.

What evidence supports NDUFB5 as a potential therapeutic target for diabetic complications?

Several lines of evidence position NDUFB5 as a promising therapeutic target for diabetic complications, particularly diabetic foot ulcers (DFU):

  • Altered Expression in Diabetic Conditions:

    • Studies demonstrate reduced NDUFB5 expression in diabetic skeletal muscle, correlating with altered metabolism of carbohydrates, energy, and amino acids

    • This expression pattern suggests that NDUFB5 deficiency may contribute to diabetic pathophysiology

  • In Vitro Functional Evidence:

    • NDUFB5 overexpression promotes cell viability, migration, and mitochondrial respiration in human umbilical vein endothelial cells (HUVECs) treated with advanced glycation end products (AGEs), which mimic diabetic conditions

    • These cellular processes are critical for wound healing and are typically impaired in diabetic complications

  • In Vivo Wound Healing Studies:

    • Adenovirus-mediated NDUFB5 overexpression (Ad-NDUFB5) accelerates skin wound healing in streptozotocin (STZ)-induced diabetic mice

    • Histological assessment through H&E staining confirmed improved wound healing parameters in NDUFB5-overexpressing animals

  • Molecular Pathway Identification:

    • Elucidation of the METTL3-m6A-NDUFB5 regulatory axis provides specific molecular targets for therapeutic intervention

    • This mechanistic understanding enables targeted approaches to enhance NDUFB5 expression or function

  • Potential Intervention Strategies:

    • Direct NDUFB5 augmentation through gene therapy approaches

    • Targeting METTL3 or IGF2BP2 to enhance NDUFB5 expression through established regulatory pathways

    • Development of small molecules that stabilize NDUFB5 or enhance its integration into Complex I

Researchers focusing on translational applications should consider that successful therapeutic targeting of NDUFB5 will likely require tissue-specific approaches to avoid systemic effects on mitochondrial function in tissues where normal NDUFB5 activity is essential.

How do interspecies variations in NDUFB5 structure impact experimental design and interpretation?

Understanding interspecies differences in NDUFB5 is crucial for experimental design and data interpretation:

For translational research, understanding these interspecies differences is particularly important when attempting to extrapolate findings from animal models to human applications in conditions like diabetic wound healing.

What are common pitfalls in NDUFB5 detection and quantification?

Researchers commonly encounter several challenges when working with NDUFB5:

  • Antibody Specificity Issues:

    • NDUFB5's relatively small size (approximately 16 kDa) makes it susceptible to confusion with non-specific bands on Western blots

    • Mitochondrial proteins often show cross-reactivity due to structural similarities between respiratory complex subunits

    • Solution: Use blocking experiments with recombinant NDUFB5 fragments (e.g., aa 103-189) at 100x molar excess to confirm antibody specificity

  • Sample Preparation Challenges:

    • Incomplete mitochondrial protein extraction can lead to inconsistent NDUFB5 detection

    • Degradation during sample processing may affect results, particularly for this small protein

    • Solution: Use freshly prepared samples and optimize extraction buffers specifically for mitochondrial membrane proteins

  • Quantification Variability:

    • Expression levels vary naturally between tissues based on mitochondrial content

    • Normalization to appropriate controls is critical but often challenging

    • Solution: Normalize to mitochondrial markers rather than whole-cell housekeeping proteins to account for differences in mitochondrial content between samples

  • mRNA-Protein Correlation Discrepancies:

    • Post-transcriptional regulation through mechanisms like m6A modification can cause mRNA and protein levels to diverge

    • Solution: Measure both mRNA and protein levels to comprehensively assess NDUFB5 expression changes

  • Technical Parameters for Western Blotting:

    • Optimal antibody dilution (1/500) has been established for some commercial antibodies

    • Resolution of small proteins requires appropriate gel concentration and running conditions

    • Solution: Follow validated protocols with 12-15% gels and include molecular weight markers in the appropriate range

When troubleshooting NDUFB5 detection issues, researchers should include positive controls (tissues known to express NDUFB5, such as heart and kidney) and negative controls (NDUFB5 knockdown samples) to validate their detection methods.

How can researchers effectively design experiments to study NDUFB5 interactions with other Complex I components?

Studying NDUFB5's interactions with other Complex I components requires specialized techniques:

  • Co-Immunoprecipitation (Co-IP) Approaches:

    • Use mild detergents (e.g., digitonin or mild NP-40) that preserve protein-protein interactions within the complex

    • Employ antibodies against NDUFB5 or other Complex I components with confirmed specificity

    • Include appropriate controls: IgG negative controls, input controls, and reciprocal IPs

    • Consider crosslinking approaches for transient or weak interactions

  • Proximity Labeling Techniques:

    • BioID or APEX2 fusion proteins can identify proteins in close proximity to NDUFB5 within the intact mitochondrial membrane

    • These approaches are particularly valuable for mapping the Complex I interactome in living cells

    • Design constructs carefully to ensure proper mitochondrial targeting while maintaining NDUFB5 function

  • Blue Native PAGE Analysis:

    • This technique preserves native protein complexes and can reveal NDUFB5's integration into Complex I assembly intermediates

    • Use in combination with second-dimension SDS-PAGE for detailed subcomplex analysis

    • Apply to samples with NDUFB5 knockdown or overexpression to assess effects on Complex I assembly

  • Fluorescence Microscopy Approaches:

    • Fluorescence resonance energy transfer (FRET) between fluorescently tagged NDUFB5 and other Complex I components can reveal direct interactions

    • Super-resolution microscopy techniques can visualize NDUFB5 localization within the complex at nanoscale resolution

    • Live-cell imaging can capture dynamic assembly processes

  • Computational Structural Analysis:

    • Molecular docking and simulations based on available structural data can predict interaction interfaces

    • These in silico approaches can guide the design of mutations to disrupt specific interactions for functional validation

When publishing interaction studies, researchers should provide detailed methodological information, including buffer compositions, detergent concentrations, and equipment parameters to ensure reproducibility.

What controls are essential when evaluating the effects of NDUFB5 manipulation on mitochondrial function?

Proper experimental controls are critical for accurately interpreting the effects of NDUFB5 manipulation:

  • Expression Controls:

    • Empty vector controls: For overexpression studies, cells transfected with empty vectors (e.g., pcDNA3.1+) account for transfection effects

    • Scramble siRNA controls: For knockdown studies, non-targeting siRNAs (siNC) control for non-specific effects of the transfection process

    • Expression validation: Confirm NDUFB5 manipulation at both mRNA (qRT-PCR) and protein (Western blot) levels before interpreting functional results

  • Functional Controls:

    • Pharmacological benchmarks: Include known Complex I inhibitors (e.g., rotenone) or uncouplers (e.g., FCCP) as positive controls for mitochondrial function assays

    • Rescue experiments: Mitochondrial fusion promoters (e.g., M1) can help distinguish between direct effects of NDUFB5 deficiency and secondary consequences

    • Time course analysis: Evaluate effects at multiple time points to distinguish between acute and compensatory responses

  • Specificity Controls:

    • Other Complex I subunit manipulation: Compare effects of NDUFB5 manipulation with those of other Complex I subunits to identify NDUFB5-specific roles

    • Mitochondrial markers: Monitor other mitochondrial parameters (mass, membrane potential) to distinguish between NDUFB5-specific effects and general mitochondrial dysfunction

    • Off-target effect assessment: Validate key findings with alternative approaches (different siRNAs or CRISPR-based methods) to confirm specificity

  • Experimental Condition Controls:

    • Cell density standardization: Maintain consistent cell numbers across experimental conditions

    • Metabolic state control: Standardize media composition and incubation times prior to functional assays

    • Stress condition controls: For experiments involving AGEs or other stressors, include concentration gradients to establish dose-response relationships

  • Data Analysis Controls:

    • Technical replicates: Include multiple technical replicates for each biological replicate

    • Normalization standards: Use appropriate normalization methods for different assay types

    • Statistical validation: Apply appropriate statistical tests with corrections for multiple comparisons

Implementing these controls ensures that observed phenotypes can be confidently attributed to specific NDUFB5 functions rather than experimental artifacts or secondary effects.

What emerging technologies could advance our understanding of NDUFB5 function?

Several cutting-edge technologies offer promising approaches to deepen our understanding of NDUFB5:

  • Cryo-Electron Microscopy (Cryo-EM):

    • High-resolution structural analysis of NDUFB5 within intact Complex I can reveal precise molecular interactions

    • Time-resolved cryo-EM could potentially capture conformational changes during electron transfer

    • This approach would overcome limitations of crystallography for membrane protein complexes

  • CRISPR-Based Technologies:

    • CRISPR activation/interference (CRISPRa/CRISPRi) allows for precise temporal control of NDUFB5 expression

    • CRISPR base editing can introduce specific mutations to study structure-function relationships

    • CRISPR screens can identify synthetic lethal interactions with NDUFB5 dysfunction

  • Single-Cell Multi-Omics:

    • Integrated analysis of transcriptomics, proteomics, and metabolomics at single-cell resolution can reveal cell-specific responses to NDUFB5 manipulation

    • This approach would be particularly valuable in heterogeneous tissues like diabetic wounds

  • Tissue-Specific Conditional Models:

    • Development of tissue-specific and inducible NDUFB5 knockout or overexpression models

    • These would allow investigation of tissue-specific functions while avoiding developmental effects

  • m6A Epitranscriptome Mapping:

    • Advanced sequencing technologies can map m6A modifications across the transcriptome in different conditions

    • This would provide deeper insights into how NDUFB5 regulation fits within broader epitranscriptomic programs

  • Mitochondrial Imaging Advances:

    • Super-resolution microscopy combined with specific probes can visualize NDUFB5 within the dynamic mitochondrial network

    • Live-cell imaging with genetically encoded sensors can correlate NDUFB5 function with real-time changes in mitochondrial parameters

These technological advances would address current knowledge gaps regarding the precise molecular mechanisms by which NDUFB5 contributes to mitochondrial function and cellular adaptation to stress conditions.

How might NDUFB5-targeted therapies be developed for diabetic complications?

The development of NDUFB5-targeted therapies for diabetic complications could proceed along several promising avenues:

  • Gene Therapy Approaches:

    • Adenoviral delivery of NDUFB5 has already shown promise in diabetic wound healing models

    • Development of tissue-specific promoters could allow targeted expression in affected tissues

    • Advanced delivery systems (lipid nanoparticles, AAV vectors) could improve clinical translation

  • Small Molecule Modulators:

    • High-throughput screening for compounds that stabilize NDUFB5 or enhance its integration into Complex I

    • Development of small molecules that mimic the functional effects of NDUFB5 overexpression

    • Drug repurposing studies to identify approved compounds that upregulate NDUFB5 expression

  • Epitranscriptomic Interventions:

    • Targeting the METTL3-m6A-IGF2BP2 pathway to enhance NDUFB5 expression

    • Development of RNA-based therapeutics that stabilize NDUFB5 mRNA

    • Small molecules that enhance m6A writer activity or inhibit m6A erasers specifically in the context of NDUFB5 regulation

  • Combinatorial Approaches:

    • Integration of NDUFB5-targeted therapies with other mitochondrial enhancers

    • Combination with antioxidants to address both Complex I function and oxidative stress

    • Multi-target strategies addressing both NDUFB5 and downstream effectors

  • Therapeutic Monitoring:

    • Development of biomarkers for NDUFB5 function in accessible tissues

    • Non-invasive imaging approaches to assess mitochondrial function in response to therapy

    • Correlation of NDUFB5 restoration with clinical outcomes in diabetic complications

  • Personalized Medicine Applications:

    • Stratification of patients based on NDUFB5 expression or genetic variants

    • Tailored approaches for different diabetic complication subtypes

    • Consideration of mitochondrial haplogroups that may influence response to NDUFB5-targeted interventions

For researchers pursuing therapeutic development, a critical consideration will be achieving sufficient tissue specificity to enhance NDUFB5 function in affected tissues while avoiding systemic effects on mitochondrial function.

What are the key unanswered questions in NDUFB5 research?

Despite significant advances in our understanding of NDUFB5, several critical questions remain unanswered:

  • While we know NDUFB5 is essential for Complex I function, the precise molecular mechanism by which it contributes to electron transfer efficiency remains unclear. Does it play a structural role stabilizing the complex, or does it actively participate in conformational changes during the catalytic cycle?

  • The regulation of NDUFB5 expression has been linked to m6A modification, but how this integrates with other regulatory mechanisms, including transcriptional control and protein stability, requires further investigation. Are there tissue-specific regulatory mechanisms that explain differential expression patterns?

  • NDUFB5's role in diabetic wound healing has been established, but its potential involvement in other diabetic complications and mitochondrial disorders remains to be fully explored. Does NDUFB5 dysfunction contribute to diabetic cardiomyopathy, neuropathy, or nephropathy through similar mechanisms?

  • The therapeutic potential of targeting NDUFB5 has been demonstrated in preclinical models, but significant questions remain about optimal delivery methods, tissue specificity, and potential side effects of modulating this essential mitochondrial protein.

  • The interaction between NDUFB5 and other mitochondrial quality control mechanisms, including mitophagy, fission/fusion dynamics, and the mitochondrial unfolded protein response, represents an important area for future investigation.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.