Recombinant Human NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6 (NDUFB6)

Shipped with Ice Packs
In Stock

Description

Overview of NDUFB6

NDUFB6 is an accessory subunit of mitochondrial Complex I (NADH:ubiquinone oxidoreductase), which facilitates electron transfer from NADH to ubiquinone in the electron transport chain . While not directly involved in catalysis, it is essential for maintaining electron transfer activity and structural integrity of Complex I . The recombinant form enables targeted studies of mitochondrial dysfunction and metabolic diseases.

Production and Purification

Recombinant NDUFB6 is generated using various expression systems:

Expression Systems

  • Escherichia coli: Utilized for cost-effective, high-yield production (e.g., Bio-Techne’s NBP1-92172PEP) .

  • HEK293T Cells: Employed for eukaryotic post-translational modifications (Innovative Research) .

Purification Methods

  • IMAC Chromatography: For His-tagged variants .

  • SDS-PAGE Validation: Confirms molecular weight and purity .

Functional Role in Mitochondrial Respiration

NDUFB6 contributes to mitochondrial electron transport and cellular energy metabolism:

  • Electron Transfer: Facilitates NADH → ubiquinone electron flow, critical for ATP synthesis .

  • Mitochondrial Coupling: Silencing NDUFB6 in C2C12 myotubes reduces Complex I-linked respiration by 36% and impairs insulin signaling rescue after palmitate exposure .

Metabolic Disease Studies

  • Insulin Sensitivity: The NDUFB6 rs540467 SNP modulates physical activity-mediated improvements in insulin sensitivity and liver fat reduction in type 2 diabetes .

    • G/G genotype carriers show stronger correlations between physical activity and metabolic benefits .

Antibody Development

  • Immunoassays: Recombinant NDUFB6 serves as an antigen for antibody validation (e.g., Novus Antibody H00004712-B01P) .

  • Western Blot: Detects endogenous NDUFB6 in human spleen and transfected cell lysates .

Table 1: NDUFB6 Polymorphism and Metabolic Response

GenotypePhysical Activity ResponseImpact on Insulin Sensitivity
G/GStrong correlation with improved M-valuesReduced waist circumference, FLI
A-alleleNo significant associationUnchanged metabolic parameters

Table 2: In Vitro Effects of NDUFB6 Silencing

ParameterControlNDUFB6 siRNA
Complex I-linked respiration100%64%
Insulin-stimulated AktRestoredNot restored

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for your reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
NDUFB6; NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6; Complex I-B17; CI-B17; NADH-ubiquinone oxidoreductase B17 subunit
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
2-128
Protein Length
Full Length of Mature Protein
Species
Homo sapiens (Human)
Target Names
Target Protein Sequence
TGYTPDEKLRLQQLRELRRRWLKDQELSPREPVLPPQKMGPMEKFWNKFLENKSPWRKMV HGVYKKSIFVFTHVLVPVWIIHYYMKYHVSEKPYGIVEKKSRIFPGDTILETGEVIPPMK EFPDQHH
Uniprot No.

Target Background

Function
NDUFB6 is an accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I). It is not believed to be directly involved in catalysis. Complex I facilitates electron transfer from NADH to the respiratory chain, with ubiquinone considered the immediate electron acceptor.
Gene References Into Functions
  1. NDUFB6 is a potential tumor suppressor in metastatic clear cell renal cell carcinomas (ccRCCs). PMID: 25315157
  2. NDUFS6 (likely a typo, should be NDUFB6) contains a Zn-binding site and is crucial for mitochondrial Complex I biogenesis. PMID: 25902503
  3. The NDUFB6 subunit is essential for Complex I activity. PMID: 21964293
  4. Genetic, epigenetic, and non-genetic factors influence NDUFB6 expression in human muscle, potentially interacting to increase age-related insulin resistance susceptibility. PMID: 17948130
  5. A polymorphism in the NDUFB6 gene, linked to respiratory chain Complex I, ATP synthesis, and insulin sensitivity response to exercise, has been identified in relatives of individuals with type 2 diabetes. PMID: 19265027
Database Links

HGNC: 7701

OMIM: 603322

KEGG: hsa:4712

STRING: 9606.ENSP00000369176

UniGene: Hs.493668

Protein Families
Complex I NDUFB6 subunit family
Subcellular Location
Mitochondrion inner membrane; Single-pass membrane protein; Matrix side.

Q&A

What is the molecular structure and biochemical function of NDUFB6?

NDUFB6 (also known as complex I-B17) is an accessory subunit of mitochondrial respiratory complex I with a molecular weight of 15.5 kDa and 128 amino acids. The protein exhibits an L-shaped structure with distinct domains: a hydrophobic transmembrane domain and a hydrophilic peripheral arm containing redox centers and the NADH binding site .

The N-terminal hydrophobic domain folds into an alpha helix spanning the inner mitochondrial membrane, while the C-terminal hydrophilic domain interacts with globular subunits of Complex I. This highly conserved two-domain structure is critical for its function, with the hydrophobic domain serving as an anchor for the NADH dehydrogenase complex at the inner mitochondrial membrane .

Although NDUFB6 is not directly involved in catalysis, it is essential for electron transfer activity within Complex I, which functions in transferring electrons from NADH to the respiratory chain with ubiquinone as the immediate electron acceptor .

How is the NDUFB6 gene organized and regulated at the genomic level?

The NDUFB6 gene is located on the p arm of chromosome 9 in position 21.1 (9p21.1) and spans 19,659 base pairs . The gene contains 4 exons and produces three transcript variants through alternative splicing, encoding distinct isoforms .

Regulation of NDUFB6 expression involves complex genetic and epigenetic mechanisms:

Regulatory FactorEffect on NDUFB6 Expression
AgeExpression decreases in elderly subjects compared to younger individuals
InsulinModest but significant increase in mRNA levels after insulin stimulation
Genetic variantsrs629566 (A/G) polymorphism affects expression in an age-dependent manner
DNA methylationNegatively correlates with expression, particularly in elderly subjects with rs629566 G/G genotype

Heritability studies in twins estimate that approximately 60% of NDUFB6 expression variability in muscle can be attributed to genetic factors .

What methods are commonly used to detect and quantify NDUFB6 in experimental settings?

Several analytical techniques are employed to detect and quantify NDUFB6 in research:

TechniqueApplicationDetection Parameters
Western BlottingProtein detectionUsing antibodies at 1:1000-1:4000 dilution; observed molecular weight of 16-20 kDa
ImmunohistochemistryTissue localizationUsing antibodies at 1:50-1:500 dilution
RT-PCRmRNA quantificationUsing NDUFB6-specific primers for expression analysis
Blue Native Gel ElectrophoresisComplex I assemblyVisualization of intact respiratory complexes

For western blotting applications, NDUFB6 antibodies have been validated for reactivity with human, mouse, and rat samples, with positive detection in various cell lines including A549, LNCaP, MCF-7, and skeletal muscle tissues .

How can researchers effectively silence or knockout NDUFB6 expression in experimental models?

Two main approaches have been developed for NDUFB6 silencing, with varying specificity and effectiveness:

  • Lentivirus-mediated shRNA expression:
    This method often results in unpredicted extinction of additional genes beside the targeted one, due to uncontrolled genetic material insertions in the host cell genome. This approach is therefore less suitable for studying specific functions of NDUFB6 .

  • Direct miR insertion in Flp sites:
    Specific extinction of NDUFB6 can be achieved by direct insertion of a miR targeting CI subunits in a Flp site (using HEK293 Flp-In cells). This approach provides a more precise genetic manipulation and has been successfully used to demonstrate that NDUFB6 is required for complex I activity .

  • siRNA silencing in differentiated myocytes:
    For metabolic studies, researchers have successfully silenced Ndufb6 in C2C12 myotubes on day 4 of differentiation (when NDUFB6 mRNA expression is maximal and stable). Treatment for 24 hours with siRNA reduced Ndufb6 protein levels by approximately 40% .

Researchers can also utilize cell lines with null mutations for NDUFB6, such as Chinese hamster cells, for comparative studies .

What are the functional assays to evaluate NDUFB6's impact on mitochondrial respiration?

Several functional assays can be used to assess the impact of NDUFB6 on mitochondrial respiration:

  • Complex I-linked respiration:
    Measures state u respiration (maximal uncoupled respiration) linked to complex I activity. In Ndufb6-silenced myotubes, this parameter decreased by 36% compared to control .

  • CETF-linked respiration:
    Evaluates electron-transferring flavoprotein complex respiration, which was not significantly affected by Ndufb6 silencing .

  • Respiratory Control Ratio (RCR):
    An indicator of mitochondrial coupling efficiency that remains unaffected by Ndufb6 silencing .

  • Leak Control Ratio (LCR):
    A measure of proton leak that was not significantly changed by Ndufb6 silencing .

  • Insulin-stimulated Akt phosphorylation:
    After palmitate incubation and electric pulse stimulation (EPS)-induced contractions, this assay can reveal how Ndufb6 silencing affects insulin signaling. EPS restored palmitate-inhibited insulin signaling in control myotubes but failed to do so in Ndufb6-silenced myotubes .

ParameterControl MyotubesNdufb6-silenced MyotubesEffect of EPS-induced Contractions
Complex I-linked respirationNormalDecreased by 36%Increased in control, no effect in Ndufb6-silenced
CETF-linked respirationNormalNo significant changeNot specified
Respiratory Control RatioNormalNo significant changeNot specified
Leak Control RatioNormalNo significant changeNot specified
Insulin-stimulated pAkt-Ser473 after palmitateReducedReducedRestored in control, remained reduced in Ndufb6-silenced

How can researchers study the assembly of NDUFB6 into the mitochondrial respiratory complex I?

Studying NDUFB6 incorporation into complex I requires specialized techniques:

  • Blue Native Gel Electrophoresis (BNG):
    This technique separates intact mitochondrial respiratory complexes and can be combined with in-gel histochemical assays to measure complex I activity. Studies have shown absence of immunodetectable complex I subunits including NDUFB6 in patient samples with complex I deficiency .

  • Immunoblot analysis:
    Western blotting with antibodies against various complex I subunits can assess the impact of NDUFB6 deficiency on complex assembly. Researchers can examine both peripheral arm components (NDUFS2, NDUFA13, NDUFS8) and membrane arm components (NDUFB6, NDUFB8) .

  • Structural modeling:
    For advanced structural studies, computational approaches using MODELLER have been employed to generate models for subunits including NDUFB6 when homology models were unsatisfactory .

  • Transmitochondrial cybrid technology:
    This approach allows for the study of mitochondrial-nuclear compatibility by transferring patient mtDNA into rho° cells following nuclear inactivation with actinomycin D .

How do genetic polymorphisms in NDUFB6 affect its expression and function?

Research has identified several polymorphisms in NDUFB6 with significant functional consequences:

  • rs629566 (A/G) in promoter region:
    This polymorphism creates a potential DNA methylation site by changing the sequence CA to CG at position -544. It shows age-dependent effects on NDUFB6 expression:

    • Young subjects with G/G genotype: Higher NDUFB6 expression compared to A/G or A/A carriers

    • Elderly subjects with G/G genotype: Lower NDUFB6 expression compared to A/G or A/A carriers

  • rs540467:
    This SNP modulates physical activity-mediated changes in:

    • Insulin sensitivity

    • Body composition

    • Liver fat estimates in type 2 diabetes

    The A allele of rs540467 is associated with failure to improve insulin sensitivity with increased physical activity .

These findings demonstrate how genetic variation in NDUFB6 contributes to individual differences in mitochondrial function and metabolic responses to exercise and aging.

What is the role of DNA methylation in regulating NDUFB6 expression?

DNA methylation plays a crucial role in age-dependent regulation of NDUFB6 expression:

  • The rs629566 G/G genotype creates a methylation site at position -544 in the NDUFB6 promoter. Three additional methylation target sites exist at positions -634, -663, and -676 .

  • These sites show differential methylation patterns based on age and genotype:

    • In young subjects with rs629566 G/G genotype: No methylation detected

    • In elderly subjects with rs629566 G/G genotype: Approximately 58% ± 16% of sites are methylated

  • The degree of DNA methylation correlates negatively with NDUFB6 expression levels in both basal (r = -0.61; p < 0.05) and insulin-stimulated states .

This epigenetic regulation explains the paradoxical finding that while young G/G carriers have higher NDUFB6 expression, elderly G/G carriers have reduced expression compared to other genotypes.

How does aging affect NDUFB6 expression and what are the metabolic consequences?

Aging has significant effects on NDUFB6 expression with important metabolic implications:

ParameterYoung TwinsElderly TwinsStatistical Significance
Basal NDUFB6 mRNA levels0.36 ± 0.010.28 ± 0.01p < 0.0005
Insulin-stimulated NDUFB6 mRNA levels0.39 ± 0.010.33 ± 0.01p < 0.007
DNA methylation at NDUFB6 promoter (G/G genotype)None detected58% ± 16%Significant

Consequences of age-related NDUFB6 reduction include:

  • Decreased mitochondrial respiratory capacity

  • Reduced insulin sensitivity

  • Altered response to physical activity

  • Compromised ability to maintain energy homeostasis

These age-related changes in NDUFB6 expression contribute to the decline in oxidative metabolism and increased susceptibility to insulin resistance and type 2 diabetes with advancing age .

How does NDUFB6 contribute to exercise-induced metabolic adaptations?

NDUFB6 plays a crucial role in mediating metabolic benefits of physical activity:

  • Genetic influence on exercise response:

    • The rs540467 SNP modulates physical activity-mediated changes in insulin sensitivity and liver fat estimates

    • Carriers of the A allele show non-response to physical activity for insulin sensitivity improvement

    • G allele carriers exhibit greater improvement of muscle ATP synthase flux after exercise training

  • Mechanistic insights from cell models:

    • EPS-induced contractions (an in vitro model of exercise) increase complex I-linked respiration in control cells but not in NDUFB6-silenced cells

    • NDUFB6 is required for contraction-mediated protection against palmitate-induced insulin resistance

    • Silencing NDUFB6 abolishes the beneficial effects of contractions on insulin signaling

These findings suggest that NDUFB6 is a key component in the molecular machinery linking physical activity to metabolic health improvements.

What is the relationship between NDUFB6 dysfunction and mitochondrial disease?

Although the search results don't specifically address NDUFB6 mutations as direct causes of mitochondrial disease, they provide important context:

  • Complex I deficiency is the most common cause of mitochondrial diseases, particularly affecting the heart in mitochondrial cardiomyopathies .

  • The NDUFB6 subunit is required for electron transfer activity, and its dysfunction contributes to complex I deficiency .

  • In patients with complex I deficiency, researchers observed reduced levels of multiple complex I subunits including NDUFB6, with corresponding reduction in complex I activity within Blue Native Gels .

  • NDUFB6 interacts with mtDNA-encoded complex I subunits during assembly, suggesting that incompatibility between nuclear-encoded NDUFB6 variants and mitochondrial DNA variants could contribute to mitochondrial dysfunction .

This information highlights NDUFB6's potential role in the pathogenesis of mitochondrial disorders, particularly those involving complex I deficiency.

How is NDUFB6 involved in metabolic regulation and insulin sensitivity?

NDUFB6 plays a significant role in metabolic health through several mechanisms:

  • Expression in diabetic conditions:
    NDUFB6 is among the set of oxidative phosphorylation genes showing significant reduction in muscle from patients with type 2 diabetes compared to healthy controls .

  • Association with insulin sensitivity:

    • NDUFB6 expression levels in human skeletal muscle correlate with insulin sensitivity

    • The degree of DNA methylation in the NDUFB6 promoter negatively correlates with expression, which in turn associates with reduced insulin sensitivity

  • Mechanistic insights from cell models:

    • NDUFB6 silencing in myotubes prevents contraction-mediated rescue from palmitate-induced insulin resistance

    • This suggests that NDUFB6 is required for the beneficial effects of muscle contraction on insulin signaling

  • Genetic associations:

    • The rs540467 SNP is associated with insulin sensitivity and metabolic parameters

    • In some studies, carriers of the rs540467 A/A genotype showed increased risk of type 2 diabetes with odds ratios of 2.06 (screening cohort) and 1.40 (replication cohort)

These findings position NDUFB6 as a potential link between mitochondrial function, physical activity, and insulin sensitivity, with implications for understanding and treating metabolic disorders.

How can researchers investigate interactions between NDUFB6 and other complex I subunits?

Investigating NDUFB6's interactions with other complex I components requires sophisticated approaches:

  • Blue Native Gel Electrophoresis coupled with mass spectrometry:
    This approach can identify proteins that co-migrate with NDUFB6 and may interact with it during complex I assembly.

  • Co-immunoprecipitation with antibodies against NDUFB6:
    This technique can pull down NDUFB6 along with its interaction partners for subsequent identification.

  • Crosslinking studies:
    Chemical crosslinking followed by mass spectrometry can identify proteins in close proximity to NDUFB6 within the intact complex.

  • Structural modeling:
    Computational approaches have been used to generate structural models of NDUFB6 within complex I when homology models were unsatisfactory .

  • Genetic complementation studies:
    Expressing NDUFB6 variants in null cell lines (like the Chinese hamster cells mentioned in the search results) can identify residues crucial for interactions with other subunits .

What are the current challenges and limitations in NDUFB6 research?

Several challenges remain in studying NDUFB6:

  • Structural complexity:
    As part of the 45-subunit complex I, understanding NDUFB6's specific role requires sophisticated structural biology approaches.

  • Tissue-specific effects:
    NDUFB6 may have different regulatory mechanisms and functions in different tissues, requiring tissue-specific research approaches.

  • Genetic and epigenetic interplay:
    The complex interaction between genetic variants and epigenetic modifications in regulating NDUFB6 expression requires integrated research approaches.

  • Translation to human health:
    While associations between NDUFB6 variants and metabolic parameters have been observed, establishing causal relationships and therapeutic implications remains challenging.

  • Technical limitations:
    As noted in the search results, approaches like lentivirus-mediated shRNA expression can lead to off-target effects, complicating the interpretation of experimental results .

How can NDUFB6 research contribute to the development of therapies for mitochondrial disorders?

NDUFB6 research offers several avenues for therapeutic development:

  • Identifying compensatory mechanisms:
    Understanding how cells compensate for complex I dysfunction could reveal therapeutic targets. For example, calcium uniporter stabilization has been shown to preserve energetic homeostasis during complex I impairment .

  • Personalized exercise prescriptions:
    Knowledge of how NDUFB6 variants influence response to physical activity could enable personalized exercise recommendations for patients with metabolic disorders .

  • Epigenetic interventions:
    The role of DNA methylation in regulating NDUFB6 expression suggests potential for epigenetic therapies that could restore normal expression patterns in elderly individuals or those with specific genetic variants .

  • Gene therapy approaches:
    Understanding NDUFB6's role in complex I assembly could inform gene therapy strategies for mitochondrial disorders caused by complex I deficiency.

  • Pharmacological targeting: Identifying compounds that can modulate NDUFB6 expression or function could provide new therapeutic options for mitochondrial and metabolic disorders.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.