Recombinant Human NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial (NDUFB8)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid forms have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
Note: While the tag type is determined during production, please specify your preferred tag type for prioritized development.
Synonyms
NDUFB8; NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial; Complex I-ASHI; CI-ASHI; NADH-ubiquinone oxidoreductase ASHI subunit
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
29-186
Protein Length
Full Length of Mature Protein
Species
Homo sapiens (Human)
Target Names
Target Protein Sequence
ASHMTKDMFPGPYPRTPEERAAAAKKYNMRVEDYEPYPDDGMGYGDYPKLPDRSQHERDP WYSWDQPGLRLNWGEPMHWHLDMYNRNRVDTSPTPVSWHVMCMQLFGFLAFMIFMCWVGD VYPVYQPVGPKQYPYNNLYLERGGDPSKEPERVVHYEI
Uniprot No.

Target Background

Function
Recombinant Human NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial (NDUFB8) is an accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I). It is not believed to be directly involved in catalysis. Complex I facilitates electron transfer from NADH to the respiratory chain, with ubiquinone considered the immediate electron acceptor.
Gene References Into Functions
  1. NDUFB8 is implicated in childhood-onset mitochondrial disease. PMID: 29429571
  2. Studies have reported PTEN and NDUFB8 aberrations in cervical cancer tissue. PMID: 17727244
Database Links

HGNC: 7703

OMIM: 602140

KEGG: hsa:4714

STRING: 9606.ENSP00000299166

UniGene: Hs.523215

Protein Families
Complex I NDUFB8 subunit family
Subcellular Location
Mitochondrion inner membrane; Single-pass membrane protein; Matrix side.

Q&A

Basic Research Questions

What experimental strategies validate NDUFB8's role in mitochondrial Complex I stability?

  • Methodological approach:

    • Use siRNA knockdown in cell lines (e.g., HEK293) to assess Complex I assembly via Blue Native PAGE .

    • Measure oxygen consumption rates (OCR) before/after knockdown using Seahorse XF Analyzers .

    • Validate rescue experiments by reintroducing recombinant NDUFB8 via lentiviral transduction .

How do researchers distinguish NDUFB8-specific dysfunction from broader Complex I defects?

  • Key techniques:

    • Perform quadruple immunofluorescent assays to quantify NDUFB8 abundance relative to other subunits (e.g., COX-I) in muscle fibers .

    • Compare enzymatic activity of isolated Complex I (NADH:ubiquinone oxidoreductase assay) in samples with/without NDUFB8 mutations .

    • Analyze mitochondrial supercomplex formation via 2D-BN-PAGE .

What quality control measures ensure recombinant NDUFB8 functionality?

  • Validation workflow:

    • Confirm purity (>90%) via 12.5% SDS-PAGE with Coomassie Blue staining .

    • Test antigenicity using antibody competition assays (e.g., Novus Biologicals NBP3-17898PEP) .

    • Verify structural integrity via circular dichroism (CD) spectroscopy .

Advanced Research Challenges

How to resolve contradictions in NDUFB8 solubility across expression systems?

Expression SystemSolubility IssueMitigation Strategy
E. coli (GST-tagged)Inclusion bodiesRefold using urea gradient dialysis
Wheat germ (full-length)Low yieldOptimize cell-free transcription/translation conditions
HEK293 (native)Post-translational modificationsUse protease inhibitors during purification

What methodologies identify NDUFB8 nitration in oxidative stress models?

  • Step-by-step protocol:

    • Treat endothelial cells with peroxynitrite (ONOO⁻) to induce nitration .

    • Immunoprecipitate NDUFB8 using anti-nitrotyrosine antibodies.

    • Confirm nitration sites via LC-MS/MS (e.g., Tyr-76 and Tyr-128) .

    • Correlate findings with mitochondrial membrane potential (ΔΨm) using TMRE staining .

How to reconcile conflicting biochemical data on NDUFB8’s catalytic role?

  • Critical analysis framework:

    • Compare accessory subunit vs. structural subunit hypotheses using:

      • Cryo-EM structures (e.g., PDB 5XTD) to map NDUFB8’s position in Complex I .

      • Kinetic assays with/without recombinant NDUFB8 supplementation .

    • Prioritize studies showing >60% Complex I activity loss in NDUFB8-deficient fibroblasts .

Translational Research Considerations

What in vivo models best recapitulate NDUFB8-linked Leigh syndrome phenotypes?

  • Model comparison:

    ModelAdvantagesLimitations
    Ndufb8 KO miceProgressive encephalopathy, lactic acidosisHigh perinatal mortality
    Zebrafish morphantsRapid screening of cardiac defectsLimited CNS pathology resolution
    Patient-derived iPSCsHuman mutation contextVariable differentiation efficiency

How to optimize NDUFB8-targeted antibody validation for immunohistochemistry?

  • Validation checklist:

    • Test cross-reactivity against other Complex I subunits (e.g., NDUFS3) via Western blot .

    • Use tissues from NDUFB8 mutation carriers as negative controls .

    • Quantify signal linearity across dilution series (R² >0.95 required) .

What bioinformatics pipelines prioritize NDUFB8 variants for functional testing?

  • Variant prioritization criteria:

    • CADD score >20 .

    • Conservation across 100 vertebrate species (PhyloP >1.5) .

    • Structural proximity to ubiquinone-binding sites (≤5Å) .

    • Co-segregation in pedigrees with Leigh syndrome .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.