Recombinant Human NADH dehydrogenase [ubiquinone] 1 subunit C2 (NDUFC2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
NDUFC2; HLC1; NADH dehydrogenase [ubiquinone] 1 subunit C2; Complex I-B14.5b; CI-B14.5b; Human lung cancer oncogene 1 protein; HLC-1; NADH-ubiquinone oxidoreductase subunit B14.5b
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-119
Protein Length
Full length protein
Species
Homo sapiens (Human)
Target Names
Target Protein Sequence
MIARRNPEPLRFLPDEARSLPPPKLTDPRLLYIGFLGYCSGLIDNLIRRRPIATAGLHRQ LLYITAFFFAGYYLVKREDYLYAVRDREMFGYMKLHPEDFPEEDKKTYGEIFEKFHPIR
Uniprot No.

Target Background

Function

NDUFC2 is an accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I). While not believed to be directly involved in catalysis, it plays a role in the complex's function of transferring electrons from NADH to the respiratory chain. Ubiquinone is considered the enzyme's immediate electron acceptor.

Gene References Into Functions

NDUFC2 Gene Function and Clinical Significance:

  1. Studies have shown that both fibroblasts from heterozygous Ndufc2 knockout rats and human PBMCs homozygous for the rs11237379/NDUFC2 variant (associated with reduced gene expression) exhibit mitochondrial dysfunction, increased reactive oxygen species generation, and mitochondrial damage. (PMID: 28973657)
  2. NDUFC2 single nucleotide polymorphisms (SNPs) have been linked to an increased risk of early-onset ischemic stroke. (PMID: 26888427)
  3. Gene expression profiling in colorectal carcinoma did not reveal differential expression of NDUFC2. (PMID: 25804238)
  4. Exercise has been shown to decrease DNA methylation of genes involved in retinol metabolism and calcium signaling pathways, including NDUFC2. (PMID: 23028138)
  5. Reduced NDUFC2 gene expression has been observed in both classic and follicular variants of papillary thyroid carcinoma. (PMID: 21509594)

Database Links

HGNC: 7706

OMIM: 603845

KEGG: hsa:4718

STRING: 9606.ENSP00000281031

UniGene: Hs.407860

Protein Families
Complex I NDUFC2 subunit family
Subcellular Location
Mitochondrion inner membrane; Single-pass membrane protein; Matrix side.

Q&A

What is the cellular localization and function of NDUFC2?

NDUFC2 is an accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I). It is an integral membrane protein primarily localized to the mitochondrial inner membrane with orientation toward the intermembrane space. While not directly involved in catalysis, NDUFC2 plays a critical role in the assembly and stability of Complex I, which functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone . NDUFC2 has extensive contacts with other subunits, including interactions with 12 different proteins spanning multiple modules (ND1, ND2, and ND4) .

What alternative nomenclature exists for NDUFC2?

NDUFC2 is also known by several alternative designations in the literature:

  • Complex I-B14.5b

  • CI-B14.5b

  • Human lung cancer oncogene 1 protein (HLC-1)

  • NADH-ubiquinone oxidoreductase subunit B14.5b

  • NADHDH2 (less common)

These alternative names reflect its historical identification and functional characterization in different research contexts .

How does NDUFC2 contribute to Complex I assembly?

NDUFC2 serves as a critical scaffold protein during Complex I assembly, particularly for the membrane arm. Experimental evidence from complexome profiling shows that NDUFC2 is essential for the proper assembly of the ND2 module within the proton-pumping domain. In the absence of functional NDUFC2, Complex I assembly stalls, resulting in the accumulation of specific assembly intermediates .

Mechanistically, NDUFC2 facilitates the incorporation of the ND1 subunit into the inner mitochondrial membrane. The protein locates to the intermembrane space and interacts with numerous other subunits, including NDUFA8 within the ND1 module, multiple ND2 module subunits (NDUFA10, NDUFA11, NDUFS5, NDUFC1, and ND2), and ND4 module constituents (NDUFB1, NDUFB5, NDUFB10, NDUFB11, and ND4) . These extensive interactions explain why NDUFC2 deficiency leads to broad disruption of Complex I assembly.

How can researchers experimentally assess NDUFC2's role in mitochondrial function?

To assess NDUFC2's role in mitochondrial function, researchers should employ a multi-parameter approach:

  • Complex I assembly analysis: Blue Native PAGE followed by western blotting or complexome profiling to visualize assembly intermediates

  • Mitochondrial membrane potential: JC-1 or TMRM fluorescence assays

  • ATP production: Luminescence-based ATP assays

  • Reactive oxygen species (ROS) production: DCF-DA or MitoSOX fluorescence assays

  • Oxygen consumption rate: Respirometry using platforms such as Seahorse XF analyzer

Studies have shown that NDUFC2 disruption leads to reduced mitochondrial membrane potential, decreased ATP levels, and increased ROS production both in vitro and in vivo . These parameters provide quantifiable metrics for evaluating NDUFC2 function.

What pathogenic variants of NDUFC2 have been identified and how do they affect protein function?

Two confirmed pathogenic variants have been documented in cases of mitochondrial disease presenting with Leigh syndrome:

VariantNucleotide ChangeProtein ChangeFunctional Effect
1c.346_*7delp.(His116_Arg119delins21)Homozygous loss-of-function
2c.173A>Tp.(His58Leu)Missense variant affecting highly conserved residue

Both variants result in similar biochemical consequences, including decreased NDUFC2 protein levels and reduction of other Complex I subunits. Fibroblasts from affected individuals show defective ND1 module assembly or stability, with only NDUFA13 remaining detectable. The conserved His58 residue appears to play a particularly important role in ND2 module assembly or stability .

What experimental approaches can verify the pathogenicity of novel NDUFC2 variants?

To verify the pathogenicity of novel NDUFC2 variants, researchers should implement the following methodology:

  • Lentiviral rescue experiments: Introduce wild-type NDUFC2 into patient-derived fibroblasts to assess phenotypic rescue. Successful complementation should demonstrate increased steady-state levels of Complex I subunits and improved assembly of the holoenzyme .

  • Complex I subunit analysis: Western blot analysis to measure levels of various Complex I subunits, particularly those within the ND1, ND2, and ND4 modules that interact with NDUFC2.

  • Complexome profiling: Mass spectrometry-based analysis of mitochondrial protein complexes separated by native electrophoresis to identify specific assembly defects and intermediate accumulation.

  • In vitro biochemical assays: Measure Complex I enzyme activity using spectrophotometric assays with NADH and artificial electron acceptors.

  • Structural modeling: In silico analysis of variant effects on protein structure and interactions based on cryo-EM structures of Complex I.

How does NDUFC2 dysfunction contribute to stroke susceptibility?

NDUFC2 dysfunction has been implicated in increased stroke susceptibility through several mechanisms:

  • Mitochondrial dysfunction: Reduced NDUFC2 expression causes Complex I deficiency, leading to decreased ATP production and increased oxidative stress.

  • Increased inflammation: NDUFC2 deficiency promotes inflammatory responses both in vitro and in vivo, contributing to vascular pathologies.

  • Genetic evidence: In stroke-prone spontaneously hypertensive rats (SHRSP), Ndufc2 is significantly downregulated compared to stroke-resistant SHR (SHRSR) under specific dietary conditions .

  • Human genetic association: The T allele variant at NDUFC2/rs11237379 is associated with reduced gene expression and increased occurrence of early-onset ischemic stroke through a recessive mode of transmission (odds ratio [OR], 1.39; CI, 1.07–1.80; P=0.012). Individuals carrying both TT/rs11237379 and the A allele variant at NDUFC2/rs641836 show further increased stroke risk (OR=1.56; CI, 1.14–2.13; P=0.006) .

The experimental evidence suggests that NDUFC2 plays a crucial role in maintaining mitochondrial function, and its deficiency contributes to pathologies that increase stroke susceptibility.

What animal models are available for studying NDUFC2 function and disease relevance?

Several animal models have been developed for studying NDUFC2 function:

  • SHRSP rat model: The stroke-prone spontaneously hypertensive rat naturally exhibits reduced Ndufc2 expression and develops stroke under Japanese-style stroke-permissive diet (JD) .

  • SHRSR with heterozygous Ndufc2 deletion: Stroke-resistant SHR rats carrying heterozygous Ndufc2 deletion show renal abnormalities and stroke occurrence under JD, mimicking the SHRSP phenotype .

  • Zebrafish models: While not explicitly mentioned in the provided search results, zebrafish models with CRISPR/Cas9-mediated knockout of ndufc2 could provide valuable insights into developmental aspects of Complex I deficiency.

  • Mouse models: Tissue-specific conditional knockout models would be valuable for dissecting the role of NDUFC2 in specific pathologies, though these were not specifically described in the search results.

When designing experiments with these models, researchers should consider:

  • The effects of different dietary conditions

  • Temporal aspects of disease progression

  • Tissue-specific manifestations of NDUFC2 deficiency

  • Potential compensatory mechanisms

How can researchers effectively conduct complementation studies with wild-type NDUFC2?

For effective complementation studies, researchers should follow this methodological approach:

  • Vector selection: Use lentiviral vectors with inducible promoters (e.g., doxycycline-inducible) to control NDUFC2 expression levels.

  • Transduction timing: Allow sufficient time (minimum 72 hours) for the induced wild-type NDUFC2 to be incorporated into Complex I. Studies suggest Complex I requires approximately 24 hours to fully assemble, but the presence of mutant NDUFC2 or aberrant subassembly species may affect this process .

  • Expression level monitoring: Monitor both mRNA and protein levels of the introduced wild-type NDUFC2 compared to endogenous levels in control cells.

  • Functional assessment: Measure multiple parameters of mitochondrial function (ATP production, ROS levels, membrane potential) before and after complementation.

  • Complex I assembly analysis: Use Blue Native PAGE or complexome profiling to assess the restoration of normal assembly intermediates and reduced accumulation of aberrant forms.

Note that even partial rescue of NDUFC2 levels can lead to significant improvements in Complex I assembly and function, though complete restoration to control levels may not always be achieved .

What are the most informative biochemical assays for analyzing Complex I deficiency related to NDUFC2 dysfunction?

The most informative biochemical assays include:

  • Complexome profiling: This mass spectrometry-based technique provides comprehensive information about the composition of protein complexes separated by native electrophoresis. For NDUFC2 studies, it reveals specific assembly intermediates that accumulate due to assembly defects .

  • Module-specific antibody panels: Western blotting with antibodies against specific subunits from different Complex I modules (ND1, ND2, ND4, N, and Q modules) can pinpoint which assembly steps are affected by NDUFC2 dysfunction.

  • Complex I activity assays: Spectrophotometric measurement of NADH:ubiquinone oxidoreductase activity in isolated mitochondria or permeabilized cells.

  • Oxygen consumption rate (OCR): Measuring OCR with substrates that feed electrons specifically to Complex I (pyruvate/malate) versus Complex II (succinate) can isolate Complex I-specific defects.

  • Mitochondrial ROS production: Site-specific ROS measurements can determine whether Complex I deficiency leads to increased superoxide production at this site.

Data interpretation should consider that NDUFC2 deficiency typically shows normal expression of the Q module subunits but defects in the subunits of the ND2, ND5, and N modules, with particularly notable effects on the ND1 module assembly .

What are the unexplored aspects of NDUFC2 function that merit further investigation?

Several aspects of NDUFC2 function remain unexplored and merit further investigation:

  • Tissue-specific functions: The differential expression and importance of NDUFC2 across various tissues needs further exploration, particularly given its associations with pathologies affecting diverse organs including heart, liver, thyroid, and mammary tissue .

  • Regulatory mechanisms: The transcriptional and post-translational regulation of NDUFC2 expression remains poorly understood, particularly in the context of disease states.

  • Interaction with mitochondrial dynamics: The potential role of NDUFC2 in mitochondrial fusion, fission, or mitophagy processes has not been thoroughly investigated.

  • Therapeutic targeting: Development of approaches to modulate NDUFC2 expression or function as potential therapeutic strategies for mitochondrial diseases or stroke prevention.

  • Additional disease associations: Further exploration of NDUFC2's potential role in other conditions, including its reported associations with neoplasms, diabetes, and obesity .

How might novel technologies advance our understanding of NDUFC2 biology?

Emerging technologies that could significantly advance NDUFC2 research include:

  • Cryo-electron microscopy: High-resolution structural studies of Complex I with wild-type versus mutant NDUFC2 could reveal precise molecular mechanisms of assembly defects.

  • Single-cell omics: Single-cell transcriptomics and proteomics could reveal cell-to-cell variability in NDUFC2 expression and function, particularly in heterogeneous tissues.

  • CRISPR-based screens: Genome-wide CRISPR screens could identify synthetic lethal interactions with NDUFC2 deficiency, potentially revealing new therapeutic targets.

  • Mitochondrial-targeted proteomics: Quantitative proteomics specifically focused on mitochondrial protein complexes could provide deeper insights into the consequences of NDUFC2 dysfunction.

  • Patient-derived organoids: Development of organoid models from patients with NDUFC2 mutations could provide more physiologically relevant systems for studying tissue-specific manifestations of NDUFC2 deficiency.

These technologies, combined with existing approaches, hold promise for unraveling the complex biology of NDUFC2 and its roles in health and disease.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.