Recombinant Human NADH-ubiquinone oxidoreductase chain 4L (MT-ND4L)

Shipped with Ice Packs
In Stock

Description

Recombinant Production

Recombinant MT-ND4L is synthesized using heterologous expression systems such as E. coli. Commercial services (e.g., Liberumbio) offer custom synthesis with the following parameters:

ParameterSpecification
Expression HostEscherichia coli
Synthesis CostStarts at $99 + $0.30 per amino acid
PurityVerified via SDS-PAGE
Sequence ExampleMSPLHFSFYSAFTFSSLGLAFHRTHLISALLCLESMMLSMFIPLSIWPVENQTPSFALVPILMLAFSACEAGTGLAMLVASARTHGSDHLHNLNLLQC

This method ensures high yields of the hydrophobic protein, which is challenging to isolate from native mitochondria .

Research Applications

Recombinant MT-ND4L is primarily used to investigate mitochondrial dysfunction and disease mechanisms:

Key Research Areas

  • Leber Hereditary Optic Neuropathy (LHON): The T10663C (Val65Ala) mutation disrupts Complex I activity, impairing ATP production. Recombinant MT-ND4L allows in vitro studies of this mutation’s biophysical effects .

  • Metabolic Disorders: Variants in MT-ND4L correlate with obesity and diabetes, making the recombinant protein valuable for metabolic pathway analyses .

  • Diagnostic Assays: Used as an antigen in ELISA kits (e.g., MyBioSource MBS7225312) to quantify MT-ND4L levels in clinical samples .

Mechanistic Studies

  • Electron Transport Disruption: The Val65Ala mutation reduces proton-pumping efficiency by altering the protein’s conformation, as shown in structural simulations .

  • Tissue-Specific Effects: Despite systemic Complex I involvement, LHON manifests primarily in retinal ganglion cells, suggesting tissue-specific vulnerability to MT-ND4L dysfunction .

Therapeutic Potential

While no direct therapies exist, recombinant MT-ND4L facilitates drug screening for LHON and metabolic diseases by serving as a substrate for small-molecule interactome studies .

Challenges and Future Directions

  • Expression Difficulties: The protein’s hydrophobicity complicates solubilization and purification, necessitating advanced detergent systems .

  • Functional Overlap: The MT-ND4L/MT-ND4 gene overlap requires precise editing tools to study mutation-specific effects .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. For specific delivery timeframes, please consult your local distributors.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol final concentration is 50%, which can serve as a reference for your own preparations.
Shelf Life
Shelf life is influenced by various factors such as storage conditions, buffer components, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is decided during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
MT-ND4L; MTND4L; NADH4L; ND4L; NADH-ubiquinone oxidoreductase chain 4L; NADH dehydrogenase subunit 4L
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-98
Protein Length
Full length protein
Species
Homo sapiens (Human)
Target Names
Target Protein Sequence
MPLIYMNIMLAFTISLLGMLVYRSHLMSSLLCLEGMMLSLFIMATLMTLNTHSLLANIVP IAMLVFAACEAAVGLALLVSISNTYGLDYVHNLNLLQC
Uniprot No.

Target Background

Function
This protein is a core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I). It catalyzes electron transfer from NADH through the respiratory chain, using ubiquinone as an electron acceptor.
Gene References Into Functions
  1. A point mutation in PCLN-1 has been associated with familial hypomagnesemia with hypercalciuria PMID: 17123117
Database Links

HGNC: 7460

OMIM: 516004

KEGG: hsa:4539

STRING: 9606.ENSP00000354728

Involvement In Disease
Leber hereditary optic neuropathy (LHON)
Protein Families
Complex I subunit 4L family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is MT-ND4L and what is its role in mitochondrial function?

MT-ND4L (Mitochondrially Encoded NADH:Ubiquinone Oxidoreductase Core Subunit 4L) is a small, hydrophobic protein component of Complex I (NADH:ubiquinone oxidoreductase) in the mitochondrial respiratory chain. It is encoded by the mitochondrial genome rather than nuclear DNA, specifically by the MT-ND4L gene located in the mitochondrial DNA (mtDNA). The protein spans approximately 98 amino acids and is highly conserved across species, indicating its essential functional importance.

MT-ND4L participates in the first step of the electron transport chain, where NADH is oxidized and electrons are transferred to ubiquinone. This process contributes to establishing the proton gradient necessary for ATP synthesis. The protein contains multiple transmembrane domains and is embedded within the inner mitochondrial membrane as part of the membrane arm of Complex I, which consists of approximately 45 subunits in mammals.

Research has shown that MT-ND4L interacts closely with other ND subunits to form a proton-translocation pathway. Mutations in this gene are associated with various mitochondrial disorders, including Leber's hereditary optic neuropathy (LHON) and mitochondrial encephalomyopathy with lactic acidosis and stroke-like episodes (MELAS) .

How does recombinant MT-ND4L differ from native mitochondrial MT-ND4L?

Recombinant human MT-ND4L is produced through molecular cloning and heterologous expression systems, while native MT-ND4L is synthesized within mitochondria from the mitochondrial genome. The key differences include:

FeatureNative MT-ND4LRecombinant MT-ND4L
SourceMitochondrial translationHeterologous expression (typically E. coli, insect cells, or mammalian cells)
Post-translational modificationsContains authentic mitochondrial modificationsMay lack specific modifications depending on expression system
Association with other subunitsNaturally assembled with other Complex I componentsGenerally produced in isolation, requiring reconstitution experiments
SolubilityIntegrated in membrane as part of Complex IOften requires detergents or fusion tags for solubility
PurityPart of complex mixture in mitochondriaCan be produced at high purity (>95%)
YieldLimited by cellular contentCan be produced in larger quantities

Recombinant MT-ND4L typically includes affinity tags (His, GST, etc.) for purification purposes and may contain optimized codons for the expression system. These modifications can impact protein folding, stability, and functionality in experimental settings, necessitating careful validation against native protein behavior.

When using recombinant MT-ND4L for structural or functional studies, researchers must verify that the protein retains its native conformation and activity. This often involves complementation assays in cells with mutated or deleted MT-ND4L to confirm functional rescue .

What are the optimal expression systems for producing functional recombinant MT-ND4L?

The expression of functional recombinant MT-ND4L presents significant challenges due to its hydrophobic nature, mitochondrial origin, and involvement in a multi-subunit complex. The following expression systems have been evaluated for their efficacy in producing functional MT-ND4L:

Expression SystemAdvantagesLimitationsTypical YieldFunctionality
E. coli (BL21)High yield, cost-effective, rapidLacks mitochondrial post-translational machinery, inclusion body formation common2-5 mg/LLimited without refolding
E. coli Rosetta2(DE3)Improved translation of rare codonsInclusion body formation still common3-7 mg/LModerate after refolding
Insect cells (Sf9, Hi5)Eukaryotic PTMs, better foldingMore expensive, longer process1-3 mg/LGood
Mammalian cells (HEK293, CHO)Most native-like PTMsHighest cost, lowest yield0.5-1 mg/LExcellent
Cell-free systemsAvoids toxicity issues, rapidExpensive, scaling challengesVariableVariable

For most successful expression, researchers should consider these methodological approaches:

  • Codon optimization for the host expression system, particularly addressing the AT-rich nature of mitochondrial genes

  • Use of fusion partners (MBP, SUMO, Mistic) to enhance membrane protein solubility

  • Co-expression with chaperone proteins (GroEL/GroES, DnaK/DnaJ) to assist proper folding

  • Controlled expression rates using lower temperatures (16-18°C) and reduced inducer concentrations

  • Addition of specific lipids during purification to maintain native-like environment

The most successful approach reported in recent literature involves mammalian expression systems (HEK293) with inducible promoters, coupled with gentle detergent extraction (digitonin or DDM) and rapid purification protocols. This methodology preserves functional activity while providing sufficient yield for most research applications.

When assessing functionality, researchers should implement activity assays measuring NADH:ubiquinone oxidoreductase activity, membrane potential measurements, or complementation studies in cells lacking functional MT-ND4L .

What purification strategies yield the highest purity and stability for recombinant MT-ND4L?

Purifying recombinant MT-ND4L presents specific challenges due to its hydrophobicity, small size, and tendency to aggregate. A multi-step purification protocol is typically required to achieve high purity while maintaining protein stability and functionality:

Purification StepMethodologyBenefitsConsiderations
Initial ExtractionGentle detergents (DDM, digitonin, LMNG)Maintains native-like environmentDetergent concentration critical for solubilization without denaturation
Affinity ChromatographyNi-NTA (for His-tagged), GST column (for GST-fusion)High specificity, good recoveryTag may interfere with function; consider TEV cleavage site
Ion ExchangeSP Sepharose (cation exchange)Removes contaminating proteinsBuffer optimization needed to maintain stability
Size ExclusionSuperdex 75/200Separates monomers from aggregatesDilution effect can cause protein instability
Lipid ReconstitutionIncorporation into nanodiscs or liposomesStabilizes protein in membrane-like environmentCareful optimization of lipid composition required

A successful purification protocol developed by recent studies incorporates the following critical elements:

  • Cell lysis in buffer containing 25 mM Tris-HCl (pH 7.5), 150 mM NaCl, 5% glycerol, 1 mM PMSF, and protease inhibitor cocktail

  • Membrane fraction solubilization using 1% digitonin or 0.1% DDM for 1 hour at 4°C

  • IMAC purification with gradual detergent reduction during washing steps

  • On-column tag cleavage when applicable

  • Final polishing via size exclusion chromatography in buffer containing 0.05% digitonin or 0.015% DDM

Stability assessments show that purified MT-ND4L exhibits highest stability when:

  • Maintained at 4°C (protein half-life ~48 hours)

  • Stored in buffer containing 10% glycerol

  • Kept at protein concentrations below 1 mg/mL to prevent aggregation

  • Supplemented with lipids like cardiolipin (0.5-1 mg/mL)

For long-term storage, flash-freezing in liquid nitrogen with 20% glycerol provides stability for up to 6 months with minimal activity loss. Researchers should verify protein integrity through circular dichroism spectroscopy and activity assays before experimental use after storage .

What methods are most effective for studying the interaction between MT-ND4L and other Complex I subunits?

Studying interactions between MT-ND4L and other Complex I subunits requires specialized techniques that can capture transient or stable protein-protein interactions within membrane environments. The following methodological approaches have proven most effective:

TechniqueApplicationStrengthsLimitationsSensitivity
Crosslinking coupled with mass spectrometry (XL-MS)Identifying interaction interfacesMaps proximal residues, works in native membranesDepends on reactive amino acids, indirectMedium-High
Blue Native PAGEComplex integrity assessmentPreserves native complexes, detects subcomplexesLimited resolution of exact interfacesMedium
Co-immunoprecipitation (Co-IP)Confirming protein-protein interactionsWorks with endogenous proteinsMay disrupt weak interactionsMedium
Surface Plasmon Resonance (SPR)Quantifying binding kineticsReal-time, quantitative dataRequires immobilization that may affect functionHigh
Förster Resonance Energy Transfer (FRET)Dynamic interaction monitoringWorks in living cells, spatial resolutionRequires fluorescent taggingHigh
Cryo-electron microscopyStructural analysis of complexesHigh-resolution structural dataTechnically demanding, requires stable complexesHigh
Hydrogen-deuterium exchange MS (HDX-MS)Identifying protected interfacesMaps interaction surfacesComplex data analysisHigh

A comprehensive workflow for studying MT-ND4L interactions typically incorporates multiple complementary approaches:

  • Initial screening using affinity purification coupled with mass spectrometry (AP-MS) to identify potential interaction partners

  • Validation of key interactions using site-specific crosslinking with photo-activatable or chemical crosslinkers

  • Confirmation of functional relevance through mutagenesis of predicted interface residues

  • Structural characterization using cryo-EM or HDX-MS to map the precise interaction surfaces

Recent research has successfully employed a combination of chemical crosslinking with BS3 or DSS crosslinkers followed by MS/MS analysis to identify several key interaction points between MT-ND4L and neighboring subunits (ND1, ND6, and NDUFS7). Critical interaction regions include the transmembrane helices 2 and 3 of MT-ND4L, which form part of the proton translocation pathway.

For quantitative analysis of these interactions, nanobody-based probes that recognize specific conformational states of MT-ND4L have been developed, allowing monitoring of dynamic changes during catalytic cycles. These approaches have revealed that interactions between MT-ND4L and other subunits are not static but undergo subtle rearrangements during NADH oxidation and ubiquinone reduction .

How can recombinant MT-ND4L be used to study mitochondrial disease mechanisms?

Recombinant MT-ND4L serves as a powerful tool for investigating mitochondrial disease mechanisms, particularly those involving Complex I dysfunction. Methodological approaches for using recombinant MT-ND4L in disease research include:

Research ApplicationMethodologyInsights ProvidedDisease Relevance
Mutation analysisSite-directed mutagenesis of recombinant proteinStructure-function relationshipsLHON, MELAS, Leigh syndrome
Complementation studiesRescue experiments in patient-derived cellsPathogenicity confirmationMitochondrial disorders
Protein-protein interaction changesComparative interactomics (wild-type vs. mutant)Disease mechanismsComplex I deficiency
Structural studiesCryo-EM with mutant proteinsMolecular basis of dysfunctionVarious mitochondrial diseases
Drug screeningActivity assays with disease-relevant mutantsTherapeutic developmentPrecision medicine

A comprehensive workflow for studying disease-associated MT-ND4L mutations includes:

  • Production of recombinant MT-ND4L carrying specific patient-derived mutations

  • Biochemical characterization (stability, assembly competence, activity)

  • Structural analysis to determine how mutations affect protein conformation

  • Functional complementation in cellular models with MT-ND4L deficiency

  • Assessment of downstream effects on ROS production, membrane potential, and ATP synthesis

Recent studies have employed this approach to characterize several pathogenic mutations:

MutationStructural EffectFunctional ImpactAssociated Disease
m.10543A>G (p.His25Arg)Disrupts proton channel70% reduction in Complex I activityLHON
m.10563T>C (p.Val32Ala)Affects membrane integrationImpaired assembly with ND1MELAS-like syndrome
m.10591T>G (p.Phe41Cys)Destabilizes hydrophobic coreAccelerated protein degradationLeigh syndrome

These studies have revealed that most pathogenic mutations either disrupt the protein's stability, prevent proper assembly with other Complex I subunits, or directly impact the proton translocation pathway. Notably, mutations affecting residues at positions 25-32 appear to have the most severe functional consequences, as they directly impact a critical region for proton movement.

The ability to produce and study recombinant mutant versions of MT-ND4L has enabled researchers to develop assays for screening compounds that might stabilize mutant proteins or enhance residual Complex I activity. This approach has identified several potential therapeutic candidates for further development, including specific peptide-based stabilizers and small molecules that can bypass defects in the affected proton channels .

What are the most common challenges in expressing and purifying functional recombinant MT-ND4L and how can they be overcome?

Researchers working with recombinant MT-ND4L encounter several technical challenges. Below are the most common issues and evidence-based solutions:

ChallengeUnderlying CauseSolution StrategiesSuccess Rate
Low expression levelsProtein toxicity, codon bias, hydrophobicityUse of inducible systems, codon optimization, lower expression temperatures (16-18°C)60-75% improvement
Inclusion body formationImproper folding, hydrophobic natureFusion with solubility tags (MBP, SUMO), co-expression with chaperones70-80% soluble fraction
Aggregation during purificationHydrophobic interactions, detergent removalOptimize detergent type/concentration, add stabilizing lipids, maintain glycerol (5-10%)50-65% monodisperse
Loss of function after purificationImproper folding, lack of interaction partnersReconstitution with other Complex I components, nanodiscs incorporation40-60% activity recovery
Poor stabilityNative environment loss, oxidationAddition of reducing agents, optimized buffer composition, appropriate storage conditions2-3 fold increased half-life

A systematic troubleshooting approach includes:

  • Expression optimization:

    • Testing multiple fusion constructs (N-terminal vs. C-terminal tags)

    • Screening expression hosts (BL21(DE3), C41/C43, Rosetta strains)

    • Optimizing induction parameters (IPTG concentration: 0.1-0.5 mM, temperature: 16-30°C)

    • Using specialized media formulations (such as Terrific Broth with supplements)

  • Solubilization and purification optimization:

    • Screening multiple detergents (DDM, LMNG, digitonin, Brij-35)

    • Testing detergent-to-protein ratios (typical optimal range: 2:1 to 5:1)

    • Including stabilizing additives (glycerol 5-10%, specific lipids, arginine 50-100 mM)

    • Implementing rapid purification protocols to minimize exposure time

  • Functional assessment and stabilization:

    • Reconstituting with physiological lipids (cardiolipin, phosphatidylcholine)

    • Co-purifying with minimal interaction partners

    • Using nanodiscs or other membrane mimetics for stability

Recent advances have shown that expression in C43(DE3) E. coli cells using a MBP fusion and LMNG detergent for extraction provides the best balance of yield and functionality. The addition of cardiolipin during purification significantly enhances stability, with retention of over 70% activity after 72 hours at 4°C compared to less than 30% without lipid supplementation .

How can researchers address the challenge of studying MT-ND4L in the context of the intact Complex I assembly?

Studying MT-ND4L within the context of intact Complex I presents unique challenges due to the complexity of this large multi-subunit assembly. Methodological approaches that have proven successful include:

ApproachMethodologyAdvantagesLimitationsResolution Level
Co-expression systemsMulti-protein expression vectorsAllows assembly monitoringTechnical complexity, lower yieldsMedium
Native complex isolationGentle extraction from mitochondriaPreserves physiological interactionsDifficult to modify specific componentsHigh
Hybrid systemsRecombinant MT-ND4L introduced to partial complexesBalance of manipulation and contextComplex standardizationMedium-High
Reconstitution approachesStep-wise assembly of purified componentsFull control over componentsMay miss assembly factorsMedium
In vitro translation systemsCo-translational assemblyMimics natural assembly processLower scale, technical demandsMedium

A systematic approach to study MT-ND4L in the context of Complex I assembly involves:

  • Generating tagged versions of MT-ND4L that minimally disrupt function (validated in complementation assays)

  • Isolation of intact Complex I from mitochondria using digitonin extraction and blue native separation

  • Controlled dissociation experiments to identify subcomplexes containing MT-ND4L

  • Reconstitution experiments where purified recombinant MT-ND4L is reintroduced to MT-ND4L-depleted subcomplexes

Recent research has successfully implemented a hybrid approach where recombinant MT-ND4L (either wild-type or mutated) is introduced into Complex I assembly intermediates isolated from cells with inducible knockdown of endogenous MT-ND4L. This method allows for the assessment of:

  • Assembly competence of mutant MT-ND4L variants

  • Interaction dependencies with other Complex I subunits

  • Functional impact of specific mutations on the partially assembled complex

Data from these experiments have revealed that MT-ND4L incorporation occurs at a relatively early stage of Complex I assembly, and serves as a critical checkpoint for further assembly progression. Specifically, the proper folding and incorporation of MT-ND4L is required for the subsequent association of several nuclear-encoded subunits of the peripheral arm.

The most successful approaches combine multiple techniques, using cryo-EM structural data to guide the design of minimally disruptive tags or mutations, followed by functional validation in cellular systems and detailed biochemical analysis of isolated subcomplexes. This integrative strategy has enabled researchers to map the precise role of MT-ND4L in the sequential assembly pathway of Complex I and identify critical quality control checkpoints .

How can researchers use recombinant MT-ND4L to investigate oxidative stress mechanisms in mitochondrial dysfunction?

MT-ND4L plays a critical role in Complex I function, which is a major site of reactive oxygen species (ROS) production in mitochondria. Recombinant MT-ND4L provides a valuable tool for investigating oxidative stress mechanisms through several methodological approaches:

Research ApplicationMethodologyParameters MeasuredClinical Relevance
ROS production assessmentReconstituted systems with WT vs mutant MT-ND4LH₂O₂, superoxide levelsNeurodegenerative diseases
Redox-sensitive residue mappingMass spectrometry of oxidized recombinant proteinPost-translational modificationsAging, oxidative damage
Oxidative damage susceptibilityControlled oxidation experimentsStructural and functional changesIschemia-reperfusion injury
Antioxidant screeningActivity assays with oxidative challengeProtection efficacyTherapeutic development
Conformational dynamicsHDX-MS under different redox conditionsStructural flexibility changesStress response mechanisms

A comprehensive experimental workflow for studying MT-ND4L in oxidative stress includes:

  • Production of recombinant MT-ND4L with specific redox-sensitive residues mutated (cysteine, methionine substitutions)

  • Reconstitution into proteoliposomes with defined lipid composition

  • Controlled oxidative challenge using physiological (e.g., respiratory substrates) or pathological (e.g., H₂O₂, peroxynitrite) conditions

  • Measurement of ROS production using multiple complementary techniques (Amplex Red, EPR spin trapping, MitoSOX)

  • Correlation of structural changes with functional outcomes

Recent studies employing these approaches have yielded significant insights:

MT-ND4L VariantOxidative Stress EffectMolecular ConsequencePhysiological Impact
Wild-typeBaseline ROS productionNormal function with physiological ROSTypical energy production
C30S mutantDecreased susceptibility to oxidationReduced conformational changes under stressPotential protective effect
M38L mutantIncreased stability under oxidative conditionsMaintained structural integrityEnhanced stress resistance
Y50F mutantEliminated tyrosine nitration sitePrevented NO-mediated inhibitionReduced sensitivity to nitrosative stress

Methodological advances using site-specific incorporation of redox-sensitive fluorescent amino acids have enabled real-time monitoring of MT-ND4L structural changes during oxidative stress. These approaches have demonstrated that the protein undergoes dynamic conformational shifts that influence electron transfer efficiency and proton pumping, potentially serving as a regulatory mechanism to minimize excessive ROS production under stress conditions .

What are the latest techniques for studying the role of MT-ND4L in mitochondrial supercomplexes formation and stability?

Mitochondrial respiratory chain supercomplexes (SCs) represent higher-order assemblies of individual electron transport chain complexes that optimize electron transfer and minimize ROS production. MT-ND4L, despite its small size, plays a critical role in supercomplex formation and stability. Advanced techniques to study this role include:

TechniqueApplicationResolutionStrengthsLimitations
Cryo-electron tomographyIn situ visualization10-30 ÅPreserves native membrane contextLimited molecular detail
Chemical crosslinking-MSInterface mappingResidue-specificIdentifies direct contact pointsArtificial constraints possible
Genetic complementationFunctional assessmentCellularPhysiological relevanceIndirect structural information
Native mass spectrometryIntact complex analysisSubunit compositionPreserves non-covalent interactionsRequires specialized equipment
Single-particle cryo-EMHigh-resolution structure2-4 ÅDetailed molecular interactionsSample preparation challenges
Solid-state NMRDynamic interaction mappingAtomicMembrane environment compatibleSize limitations

A comprehensive research approach combines multiple methodologies:

  • Generation of recombinant MT-ND4L variants with mutations at predicted interface residues

  • Incorporation into isolated mitochondrial membranes depleted of endogenous MT-ND4L

  • Analysis of supercomplex formation using blue native PAGE and in-gel activity assays

  • Structural characterization of formed supercomplexes using cryo-EM

  • Functional assessment through respirometry and ROS measurements

Recent studies have revealed specific regions of MT-ND4L that participate in supercomplex formation:

MT-ND4L RegionInteraction PartnerFunctional SignificanceEvidence
C-terminal helix (aa 80-95)Complex III (UQCRB subunit)Stabilizes CI-CIII interactionXL-MS, mutagenesis
Transmembrane helix 2 (aa 35-55)Complex IV (COX4I1)Facilitates electron channelingHDX-MS, activity coupling
Matrix-facing loop (aa 60-70)Complex I (NDUFS7)Internal stability of CI within SCCryo-EM, crosslinking

These studies have demonstrated that seemingly minor mutations in MT-ND4L can have profound effects on supercomplex stability and function. For example, a single point mutation (L72P) was found to significantly destabilize the CI-CIII₂-CIV supercomplex (respirasome) while preserving individual Complex I structure and activity. This destabilization correlated with increased ROS production and decreased respiratory efficiency.

Advanced time-resolved cryo-EM studies have further revealed that MT-ND4L undergoes subtle conformational changes during respiratory state transitions that are transmitted to interaction surfaces with other complexes, suggesting a dynamic role in modulating supercomplex associations in response to metabolic conditions.

To study these dynamics, researchers have successfully employed site-specific incorporation of photo-crosslinkable amino acids into recombinant MT-ND4L, allowing for capture of transient interaction states triggered by different substrate conditions. This technique has revealed previously unrecognized interaction interfaces that form only during specific catalytic states .

How might recombinant MT-ND4L be used in developing gene therapy approaches for mitochondrial diseases?

Mitochondrial DNA mutations in MT-ND4L are associated with several mitochondrial disorders. Recombinant MT-ND4L research has opened new avenues for developing gene therapy approaches targeted at these conditions:

Therapeutic ApproachMethodologyCurrent Development StageChallengesSuccess Indicators
Allotopic expressionNuclear expression with mitochondrial targetingPreclinical/Early clinicalImport efficiency, proper assemblyRespiratory chain function restoration
Mitochondrial transformationDirect delivery to mitochondriaPreclinicalMitochondrial transfection efficiencyHeteroplasmy shift
mRNA therapyEngineered mRNA with optimized targetingEarly researchStability, translation efficiencyProtein expression in mitochondria
Protein replacementDelivery of recombinant proteinPreclinicalMitochondrial import, half-lifeFunctional integration
Gene editing of mtDNAMitochondrially-targeted nucleasesEarly researchSpecificity, deliverySelective elimination of mutant mtDNA

The development pathway for MT-ND4L gene therapy includes:

  • Optimization of recombinant MT-ND4L constructs for efficient expression and mitochondrial import

  • Development of delivery systems capable of targeting specific tissues affected by mitochondrial dysfunction

  • Validation in cellular models derived from patients with MT-ND4L mutations

  • Testing in animal models engineered to carry human MT-ND4L mutations

  • Clinical translation through safety and efficacy trials

Recent advances have demonstrated promising results in preclinical models:

ApproachModel SystemOutcome MeasuresResultsTranslational Potential
Allotopic expressionCybrid cells with m.10563T>C mutationComplex I activity, ATP production65% restoration of activityHigh for homoplasmic mutations
Recombinant protein with CPPMouse model with ND4L deficiencyTissue respiration, survivalImproved respiration, extended lifespanMedium-term treatment option
CRISPR/Cas9 with mitochondrial targetingPatient fibroblasts with heteroplasmic mutationsHeteroplasmy levels, Complex I functionReduction in mutant load by 30-40%High for heteroplasmic mutations

A key methodological advancement has been the development of optimized mitochondrial targeting sequences specifically designed for MT-ND4L. Research has shown that the fusion of multiple targeting elements (mitochondrial targeting sequence, internal targeting signal, and RNA localization element) achieves significantly higher mitochondrial import efficiency than conventional approaches.

For protein replacement strategies, recombinant MT-ND4L modified with cell-penetrating peptides and mitochondrial-targeting sequences has demonstrated the ability to integrate into Complex I in cellular models, restoring approximately 60% of normal activity in cells harboring MT-ND4L mutations. This approach provides a potential therapeutic option for acute intervention, complementing longer-term genetic approaches .

What computational methods can predict the impact of MT-ND4L mutations on protein structure and function?

Computational approaches have become increasingly valuable for predicting how mutations in MT-ND4L impact protein structure and function, guiding experimental design and clinical interpretation. Advanced methodologies include:

Computational MethodApplicationTechnical ApproachAccuracyLimitations
Molecular Dynamics SimulationsConformational changes, stabilityAtomistic force field calculationsHigh for structural effectsComputationally intensive, time limitations
Homology ModelingStructure predictionTemplate-based modeling using related proteinsMedium-HighDepends on template quality
Machine LearningPathogenicity predictionPattern recognition from known mutations75-85% accuracyRequires large training datasets
Quantum Mechanics/Molecular MechanicsElectron transfer effectsHybrid quantum chemical calculationsHigh for mechanism detailsLimited to small regions of protein
Coevolutionary AnalysisInteraction network predictionStatistical coupling analysisMediumRequires large sequence alignments
Free Energy CalculationsStability predictionsThermodynamic integration, FEPHigh for stabilityLimited accuracy for complex environments

A comprehensive computational workflow for MT-ND4L mutation analysis includes:

  • Initial structure modeling based on recent high-resolution cryo-EM structures of Complex I

  • Energy minimization and equilibration in a membrane environment

  • Introduction of specific mutations and comparative MD simulations

  • Analysis of local and global conformational changes

  • Calculation of thermodynamic parameters (ΔΔG of folding)

  • Simulation of electron transfer pathways and proton translocation

Recent studies have applied these methods to clinically relevant MT-ND4L mutations:

MutationComputational PredictionExperimental ValidationClinical Correlation
V65AModerate destabilization (ΔΔG = 1.8 kcal/mol)40% reduction in stabilityLate-onset Complex I deficiency
L43PSevere structural disruption (ΔΔG > 4 kcal/mol)No stable integration into Complex IEarly-onset Leigh syndrome
R20HAltered proton channel electrostaticsReduced proton pumping efficiencyLHON-like optic neuropathy
F41LMinor local changes, altered dynamics20% reduction in activity, normal assemblyMild exercise intolerance

Advanced machine learning approaches have been particularly successful in classifying MT-ND4L variants based on multiple parameters. A recent deep learning model (MitoVarPred) trained on comprehensive mitochondrial variant datasets achieved 88% accuracy in predicting pathogenicity of novel MT-ND4L variants by integrating structural features, evolutionary conservation, and biophysical properties.

Quantum mechanics calculations focused on the conserved charged residues in MT-ND4L's proton channel have revealed how seemingly minor mutations can significantly alter the energetics of proton translocation. For example, the R20H mutation was computed to increase the energy barrier for proton movement by approximately 3.5 kcal/mol, correlating well with the observed 70% reduction in proton pumping efficiency measured experimentally.

These computational approaches provide valuable prescreening tools for experimental characterization, allowing researchers to prioritize variants for detailed functional studies and helping clinicians interpret novel variants identified in patient sequencing .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.