Recombinant Human NADPH oxidase 1 (NOX1)

Shipped with Ice Packs
In Stock

Description

Production and Applications in Research

Recombinant NOX1 is pivotal for studying ROS-mediated signaling. Key advancements include:

  • Antibody Development: A mouse monoclonal antibody targeting residues 224–564 was engineered to detect NOX1 in Western blot, immunohistochemistry, and flow cytometry . This antibody confirmed NOX1 overexpression in 30 colorectal cancer cell lines and surgical specimens .

  • Inhibitor Discovery: A nanomolar small-molecule NOX1 inhibitor was identified using recombinant protein assays, revealing its role in invadopodia formation and cancer cell invasion .

  • Mechanistic Studies: Recombinant NOX1 facilitated insights into phosphorylation at Threonine 429 by PKC-β1, which stabilizes the NADPH oxidase complex to promote vascular smooth muscle cell migration .

Cancer

  • Colorectal Cancer: NOX1 overexpression correlates with RAS mutations and superoxide production in tumor specimens . Knockdown reduces cisplatin resistance in gallbladder cancer cells .

  • Gastric Cancer: NF-κB-induced NOX1 activation drives metaplastic hyperplasia via ROS-dependent SOX2 upregulation in gastric stem cells .

Vascular Disease

  • NOX1-derived ROS modulate calcium influx in smooth muscle cells (SMCs), enhancing migration and neointimal hyperplasia .

  • Protein disulfide isomerase (PDI) forms a redox-dependent complex with p47phox to activate NOX1, promoting atherosclerosis and post-injury vascular remodeling .

Key Research Findings

StudyModelKey InsightCitation
NOX1 antibody validationColorectal cancer cellsConfirmed NOX1-L as the predominant superoxide-producing isoform in colon cancer
Nox1/ROS in gastric hyperplasiaK19-C2mE miceLinked NOX1 to SOX2+ stem cell expansion in preneoplastic lesions
PDI-p47phox interactionVascular SMCsIdentified disulfide bonds critical for NOX1 activation in atherosclerosis
Nox1 deficiency and cell polarityNox1 knockout miceShowed impaired lamellipodium formation due to PP2A/aPKC dysregulation

Therapeutic Implications

Targeting NOX1 shows promise in:

  • Cancer Therapy: Inhibiting NOX1 sensitizes cells to cisplatin and blocks invadopodia-driven invasion .

  • Vascular Disorders: Disrupting PDI-NOX1 interactions reduces SMC migration and neointima formation .

Product Specs

Buffer
If the delivery form is liquid, the default storage buffer is a Tris/PBS-based buffer containing 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer used before lyophilization is a Tris/PBS-based buffer containing 6% Trehalose.
Description

This recombinant Human NOX1 protein is a full-length protein expressed in vitro using a cell-free E. coli system. Its purity is greater than or equal to 85%, as determined by SDS-PAGE. Cell-free protein expression involves the in vitro synthesis of a protein using translation-compatible extracts from whole cells. Essentially, these extracts contain all the necessary macromolecules and components required for transcription, translation, and even post-translational modification. These components include RNA polymerase, regulatory protein factors, transcription factors, ribosomes, and tRNA. When supplemented with cofactors, nucleotides, and the specific gene template, these extracts can synthesize proteins of interest within a few hours.

NOX1 is predominantly expressed in colon epithelium and plays a crucial role in maintaining the epithelial barrier and mucosal homeostasis. It also promotes wound healing in the intestinal mucosa by activating focal cell-matrix adhesion proteins and cell motility. NOX1 primarily exerts its functions during tissue damage and repair by modulating the activity of repair cells, including epithelial cells, fibroblast cells, endothelial cells, and smooth muscle cells. NOX1 contributes to the rapid generation of reactive oxygen species (ROS) in response to IL-13 and interferon-gamma stimulation in human intestinal epithelial cells. NOX1 and its generated ROS further participate in intracellular signaling processes regulating the expression of genes involved in cell proliferation, differentiation, and tissue repair.

Form
Liquid or Lyophilized powder
Note: We will prioritize shipping the format that is currently in stock. However, if you have any specific requirements for the format, please indicate them in your order notes, and we will prepare the product according to your request.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial prior to opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers may use this as a reference.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
N-terminal 10xHis-tagged
Synonyms
NOX1; MOX1; NOH1; NADPH oxidase 1; NOX-1; Mitogenic oxidase 1; MOX-1; NADH/NADPH mitogenic oxidase subunit P65-MOX; NOH-1
Datasheet & Coa
Please contact us to get it.
Expression Region
1-564aa
Mol. Weight
67.7 kDa
Protein Length
Full Length
Purity
Greater than 85% as determined by SDS-PAGE.
Research Area
Others
Source
in vitro E.coli expression system
Species
Homo sapiens (Human)
Target Names
Target Protein Sequence
MGNWVVNHWFSVLFLVVWLGLNVFLFVDAFLKYEKADKYYYTRKILGSTLACARASALCLNFNSTLILLPVCRNLLSFLRGTCSFCSRTLRKQLDHNLTFHKLVAYMICLHTAIHIIAHLFNFDCYSRSRQATDGSLASILSSLSHDEKKGGSWLNPIQSRNTTVEYVTFTSIAGLTGVIMTIALILMVTSATEFIRRSYFEVFWYTHHLFIFYILGLGIHGIGGIVRGQTEESMNESHPRKCAESFEMWDDRDSHCRRPKFEGHPPESWKWILAPVILYICERILRFYRSQQKVVITKVVMHPSKVLELQMNKRGFSMEVGQYIFVNCPSISLLEWHPFTLTSAPEEDFFSIHIRAAGDWTENLIRAFEQQYSPIPRIEVDGPFGTASEDVFQYEVAVLVGAGIGVTPFASILKSIWYKFQCADHNLKTKKIYFYWICRETGAFSWFNNLLTSLEQEMEELGKVGFLNYRLFLTGWDSNIVGHAALNFDKATDIVTGLKQKTSFGRPMWDNEFSTIATSHPKSVVGVFLCGPRTLAKSLRKCCHRYSSLDPRKVQFYFNKENF
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Uniprot No.

Target Background

Function
NOH-1S is a voltage-gated proton channel that mediates the H(+) currents of resting phagocytes and other tissues. It participates in the regulation of cellular pH and is blocked by zinc. NOH-1L is a pyridine nucleotide-dependent oxidoreductase that generates superoxide and might conduct H(+) ions as part of its electron transport mechanism, whereas NOH-1S does not contain an electron transport chain.
Gene References Into Functions
  1. This study demonstrates that NOX1 loss-of-function genetic variants are present in patients with inflammatory bowel disease. PMID: 29091079
  2. Depletion of NOX1 and NOX4 partially rescued the growth inhibition of PARP1-deficient tumor xenografts. Our findings suggest that, in addition to compromising DNA damage repair, PARP inhibition or depletion may exert an additional antitumor effect by elevating oxidative stress in ovarian cancer cells. PMID: 29684820
  3. NOX activation may play a role in regulating lymphocytic activity in patients with idiopathic nephrotic syndrome through the impairment of PDGF mitogenic function and might contribute to the pathogenesis of nephrotic syndrome. PMID: 28613279
  4. The SUMO1/UBC9 axis may regulate Nox1-mediated diabetic retinopathy by inhibiting reactive oxygen species generation and apoptosis. PMID: 29138839
  5. Results indicate that the thrombospondin 1 (TSP1) and its receptor CD47 (CD47) axis selectively regulates NADPH oxidase 1 (Nox1) in the regulation of endothelial senescence, suggesting potential targets for controlling the aging process at the molecular level. PMID: 29042481
  6. In coronary artery disease (CAD), both mitochondria and NADPH oxidase contribute to flow-induced vasodilation through a redox mechanism in visceral arterioles. PMID: 28480622
  7. NADPH oxidase-mediated redox signaling is important in the detrimental effect of C-reactive protein on pancreatic insulin secretion. PMID: 28778482
  8. The S340E mutation enhances Nox1 activation (Kaito et al., 2014). The present study suggests that betaPix can also play an inhibitory role in O2(-) production, depending on the sites of phosphorylation. PMID: 29242061
  9. The anti-proliferative and pro-apoptotic effect of cambogin on breast adenocarcinoma is mediated via inducing NOX1-dependent ROS production and the dissociation of ASK1 and Trx1. PMID: 27418140
  10. Transcriptional regulation of NOX genes expression in human breast adenocarcinoma cells is modulated by the adaptor protein CIN85. PMID: 29227594
  11. The transition-state substrate analogue inhibitor of Prdx6 phospholipase A2 activity (MJ-33) was shown to suppress Nox1 activity, suggesting that Nox1 activity is regulated by the phospholipase activity of Prdx6. Finally, wild type Prdx6, but not lipase or peroxidase mutant forms, supports Nox1-mediated cell migration in the HCT-116 colon epithelial cell model of wound closure. PMID: 27094494
  12. Cells redox environment mediated by NOX1 isozymes activation down-regulates BRCA1 expression and promotes DNA homologous recombination repair in cancer. PMID: 27771433
  13. LRRC8A channels support TNFalpha-induced superoxide production by Nox1, which is required for receptor endocytosis. PMID: 27838438
  14. These results are consistent with the hypothesis that antioxidants or NOX1/4 inhibition may be useful in blocking profibrotic effects of TGFbeta on dermal and gingival fibroblasts, warranting further development as potential antifibrotic agents. PMID: 29049376
  15. We demonstrated that rapid deletion of p22phox is possible and that the activity of Nox1 and Nox4, but not Nox5, exclusively depends on p22phox. PMID: 27614387
  16. 5-HT1B receptor-dependent cellular Src-related kinase-Nox1-pathways contribute to vascular remodeling in pulmonary arterial hypertension. PMID: 28473438
  17. NOX1 plays a role in maintaining the proliferative phenotype of some colon cancers and holds potential as a therapeutic target in this disease. PMID: 28330872
  18. NOX1 mRNA was undetectable in the gastric mucosa. PMID: 27048452
  19. P38 MAPK, phosphorylated P38 MAPK, and RAC2 are regulated in mutual feedback and negative feedback regulatory pathways, resulting in the radioresistance of G0 cells. PMID: 27936335
  20. NS5A contributes to reactive oxygen species production by activating expression of NADPH oxidases 1 and 4 as well as cytochrome P450 2E1. PMID: 27200149
  21. Our results highlight that the Nox1/AKT signaling pathway plays a significant role in cell survival in oral squamous cell carcinoma (OSCC) cells. PMID: 27600098
  22. p38 and NOX1 are essential for the protective effect of c-Myb and that NOX1 acts upstream of p38 activation. PMID: 27107996
  23. The results suggested that radiation-induced pulmonary fibrosis may be efficiently reduced by specific inhibition of NOX1, an effect mediated by a reduction of fibrotic changes in endothelial cells. PMID: 27053172
  24. Overexpression of NADPH oxidase 1 is associated with increased migration/metastasis rate in melanoma. PMID: 26760964
  25. The results of this study demonstrate that osteoarthritis (OA) itself is not a cause to increase arNOX activities. PMID: 26339163
  26. These results indicate that physiological levels of ROS produced by the NOX complex modulate hippocampal neuronal polarity and axonal growth in vitro. PMID: 26101350
  27. High glucose generated an increase in NADPH oxidase activity and expression in human vascular smooth muscle cells. Sequence analysis of human Nox1, Nox4, and Nox5 gene promoters was performed. PMID: 25722086
  28. NOX1 and NOX4 signaling mediates the pathogenesis of liver fibrosis, including the direct activation of hepatic stellate cells (HSCs). PMID: 26222337
  29. Molecular switch from NOX1 to NOX2 in colon cancer cells induces ROS production and subsequently enhances MMP-7 expression by deactivating AMPK. PMID: 26116564
  30. Increased NOX1 expression in gallbladder cancer cells promoted the chemoresistance of the cells through elevating intracellular reactive oxygen species level and HIF1a expression as well as increasing MDR1 expression. PMID: 26545779
  31. NLRP3 inflammasome activation and generation of pulmonary fibrosis is affected by NADPH oxidase by multi-walled carbon nanotubes. PMID: 25581126
  32. NADPH oxidase 1 was responsible for superoxide generation and cell proliferation in low-density lipoprotein-stimulated aortic smooth muscle cells. PMID: 26065917
  33. High NADPH oxidase expression is associated with chronic myelogenous leukemia. PMID: 24833663
  34. Data show that lipopolysaccharide-induced vascular endothelial cell migration is mediated by toll-like receptor TLR-4/NF-kappa B pathway and enzyme NAD(P)H oxidase in association with the transient receptor potential melastatin 7 (TRPM7) ion channel. PMID: 25130439
  35. Enforced NOX1 expression promoted TLR4 signaling-enhanced NSCLC metastasis. PMID: 25592377
  36. Studies indicate the role of 70 kDa heat-shock protein (HSP70) in the activation of NADPH oxidase isoforms and in islet alpha- and beta-cell physiological function in health and Type 2 diabetes mellitus. PMID: 25881670
  37. Data (including data from transgenic/knockout mice) suggest that inhibition of NOX1 and NOX2/CYBB (but not NOX4) in vascular endothelium conforms to current models for the treatment of vascular diseases. [REVIEW] PMID: 25066192
  38. Nox1 post-translationally regulated CK18 stability in a ROS-, phosphorylation-, and PKCepsilon-dependent manner. It accelerates neoplastic progression by regulating structural intermediate filaments, leading to epithelial mesenchymal transition. PMID: 24494188
  39. Elevated ROS derived from NOX1 activation and downregulation of SOD in NIH3T3RET-MEN2A and NIH3T3RET-MEN 2B cells may be involved in RET constitutive tyrosine auto-phosphorylation. PMID: 24437351
  40. NOX1 is involved in acute respiratory distress syndrome pathophysiology and is responsible for the damage occurring in alveolar epithelial cells, at least in part via STAT3 signaling pathways. PMID: 24551274
  41. NOX1 inhibition not only prevented iNOS induction but also abrogated changes consequent to iNOS induction such as mesangial fibrogenesis. PMID: 23801050
  42. BetaPix phosphorylation at Ser-340 upregulates Nox1 through Rac activation. PMID: 24792722
  43. Data from studies with Caco-2 cells (an in vitro model of inflammatory bowel disease) suggest a dietary component (antioxidant/pigment indicaxanthin in fruit of cactus pear) can prevent activation of NOX1/NFkB (nuclear factor kappa B) in enterocytes. PMID: 23931157
  44. p22(phox) directly contributes to Nox1 activation in a glycosylation-independent manner, besides its significant role in Nox1 glycan maturation. PMID: 24365146
  45. It is a superoxide producing enzyme. (review) PMID: 24334927
  46. Physical frailty in older people is associated with superoxide anion overproduction by NADPH oxidase and low-grade chronic inflammation. PMID: 22640231
  47. The activity of NADPH oxidase (NOX), a major superoxide-generating enzyme system, in peripheral blood lymphocytes (PBL) from galactosemia patients, was examined. PMID: 23828587
  48. Expression of NOX-1 in beta cells is regulated in a feed-forward loop mediated by reactive oxygen species and Src-kinase. PMID: 23410839
  49. Results provide evidence that plasma from preeclampsia generates superoxide via a LOX1-NOX2-mediated pathway and downregulates endothelial KCa3.1, which may contribute to endothelial dysfunction and vasculopathy in preeclampsia. PMID: 23261940
  50. Nox1 levels were higher in the primary SW480 cells than that in metastatic SW620 cells. PMID: 23627409

Show More

Hide All

Database Links

HGNC: 7889

OMIM: 300225

KEGG: hsa:27035

STRING: 9606.ENSP00000362057

UniGene: Hs.592227

Involvement In Disease
Defects in NOX1 may play a role in the pathogenesis of very early onset inflammatory bowel disease (VEOIBD), a chronic, relapsing inflammation of the gastrointestinal tract with a complex etiology diagnosed before 6 years of age. VEOIBD is subdivided into Crohn disease and ulcerative colitis phenotypes. Crohn disease may affect any part of the gastrointestinal tract from the mouth to the anus, but the phenotype of children with onset of Crohn disease occurring younger than the age of 10 is predominantly colonic, with a lower risk of ileal disease. Bowel inflammation is transmural and discontinuous; it may contain granulomas or be associated with intestinal or perianal fistulas. In contrast, in ulcerative colitis, the inflammation is continuous and limited to rectal and colonic mucosal layers; fistulas and granulomas are not observed. Both diseases include extraintestinal inflammation of the skin, eyes, or joints.
Subcellular Location
Cell projection, invadopodium membrane; Multi-pass membrane protein. Cell membrane.
Tissue Specificity
NOH-1L is detected in colon, uterus, prostate, and colon carcinoma, but not in peripheral blood leukocytes. NOH-1S is detected only in colon and colon carcinoma cells.

Q&A

What is the basic structure of human NOX1 and how does it differ from other NADPH oxidases?

NOX1 is a membrane-bound enzyme that shares approximately 60% sequence identity with NOX2. The functional NOX1 complex requires dimerization with the p22 phox subunit and is activated by RAC1 and cytosolic factors NOXO1 and NOXA1 (NOX organizing and activator of protein 1), which are homologous to the p47 phox and p67 phox NOX2 subunits, respectively. Unlike p47 phox, NOXO1 lacks the autoinhibitory region (AIR), enabling NOX1 activation without cell stimulation. This happens through interactions of NOXO1 with characteristic lipids that colocalize it with NOX1 in resting cell membranes . NOXA1, despite having only 28% amino acid identity with p67 phox, possesses a similar domain structure that allows binding to both NOXO1 and RAC .

What is the primary function of NOX1 in cellular physiology?

The primary function of NOX1 is the generation of reactive oxygen species (ROS) following specific physiological stimuli. Unlike many other ROS-producing enzymes, NADPH oxidases like NOX1 are dedicated solely to ROS production . These ROS are not merely damaging molecules but serve as crucial cellular signaling mediators. In physiological conditions, NOX1-derived ROS regulate various cellular processes including cell proliferation, migration, differentiation, and inflammatory responses . NOX1 is particularly important in epithelial tissue homeostasis and wound healing processes .

How is NOX1 activated and regulated at the molecular level?

NOX1 activation involves a complex series of protein-protein interactions. The process requires:

  • Assembly of the NOX1 complex with p22 phox at the membrane

  • Interaction with cytosolic subunits NOXO1 and NOXA1

  • Activation by the small GTPase RAC1

RAC1 provides a major trigger for NOX1-dependent ROS generation by transitioning from a GDP-bound to a GTP-bound form, creating a higher affinity conformation that enhances NOX1 activity . Unlike NOX2, NOX1 can demonstrate constitutive activity due to NOXO1's lack of an autoinhibitory region, allowing it to interact with NOX1 even in resting cells . Additionally, intracellular calcium increases can induce NOX1 activation, as observed in response to UV radiation .

What is the tissue distribution pattern of NOX1 in normal human physiology?

NOX1 is constitutively expressed in various tissues but shows particularly high expression in specific locations:

  • Gastrointestinal tract: Highly expressed in colon epithelial cells with much lower expression in the small intestine (jejunum, ileum)

  • Vascular system: Present in vascular smooth muscle cells

  • Epithelial tissues: Found in keratinocytes, including skin (HaCaT) and gingival mucosal (GM16) cell lines

  • Reproductive system: Detected in uterus and prostate

  • Other tissues: Present in osteoclasts and activated sinusoidal endothelial cells

This differential expression pattern suggests tissue-specific roles for NOX1 in normal physiology.

How is NOX1 expression altered in pathological conditions?

NOX1 expression changes significantly in various pathological conditions:

  • Cancer: Overexpressed in colon and small intestinal adenocarcinomas and adenomatous polyps compared to adjacent uninvolved mucosae . Also detected in human melanoma cell lines .

  • Inflammatory conditions: Upregulated in response to proinflammatory cytokines like IL-13 and Interferon-γ in intestinal epithelial cells .

  • Tissue injury: Induced after hypoxia injury and influenza virus infection in lung epithelial cells .

  • UV radiation exposure: Increased expression and activity in keratinocytes following UVA and UVB radiation .

  • Diabetes-related conditions: Involved in increased expression of TGF-β and fibronectin in diabetic milieus, potentially contributing to kidney fibrogenesis .

This pathology-associated upregulation makes NOX1 a potential therapeutic target for various disorders.

What factors regulate NOX1 gene expression and protein levels?

Several factors regulate NOX1 expression at both mRNA and protein levels:

  • Growth factors: Epidermal growth factor (EGF), hepatocyte growth factor (HGF), and vascular endothelial growth factor (VEGF) can increase NOX1 expression .

  • Inflammatory cytokines: IL-13 and Interferon-γ stimulate NOX1 expression in intestinal epithelial cells .

  • Environmental stressors: UV radiation, particularly UVA and UVB, induces NOX1 expression in keratinocytes .

  • Hypoxia: Low oxygen conditions can trigger increased NOX1 expression .

  • Mechanical injury: Physical damage to tissues can upregulate NOX1 .

  • Oncogenic transformation: K-Ras transformation has been linked to altered NOX1 activity .

Interestingly, NOX1 can also induce increased expression of other NOX family members, such as NOX4 and DUOX2, in IL-13 treated intestinal epithelial cells .

What are the recommended approaches for detecting and quantifying NOX1 protein in research samples?

For reliable detection and quantification of NOX1 protein:

  • Western blot analysis: Using a validated NOX1-specific antibody that recognizes the C-terminal region of the protein. It's crucial to validate antibodies using positive controls (NOX1 overexpression systems) and negative controls (NOX1 knockout systems) .

  • Confocal microscopy: For subcellular localization studies using validated NOX1 antibodies with appropriate controls .

  • Flow cytometry: For quantifying NOX1 expression in individual cells within heterogeneous populations .

  • Immunohistochemistry: Particularly useful for tissue samples, comparing expression levels between normal and pathological specimens .

When selecting detection methods, researchers should be aware that commercial antibodies vary in specificity, and validation in systems with confirmed NOX1 expression or knockout is essential for reliable results.

What are the most effective methods for measuring NOX1-derived ROS in cellular and tissue samples?

Effective measurement of NOX1-derived ROS requires careful selection of techniques based on research objectives:

  • Lucigenin-enhanced chemiluminescence: Commonly used for superoxide detection, though it can produce artifacts if not carefully controlled.

  • Dihydroethidium (DHE) fluorescence: Useful for detecting superoxide, with oxidation products analyzable by HPLC for specificity.

  • Amplex Red assay: For hydrogen peroxide measurements, offering high sensitivity but requiring careful control experiments.

  • Genetically encoded ROS sensors: Such as HyPer or roGFP, which allow real-time monitoring of ROS production in living cells.

  • Electron spin resonance (ESR) spectroscopy: Considered the gold standard for ROS detection, though requiring specialized equipment.

For NOX1-specific ROS attribution, researchers should combine these methods with:

  • Genetic approaches (NOX1 knockdown/knockout)

  • Pharmacological inhibitors (with appropriate controls for specificity)

  • Measurements in subcellular fractions where NOX1 is localized

Appropriate experimental controls are crucial, including antioxidant treatments and NOX1-deficient samples, to confirm the source of detected ROS.

What are the key considerations for establishing recombinant NOX1 expression systems for functional studies?

When establishing recombinant NOX1 expression systems:

  • Expression system selection: Consider using mammalian cell lines that naturally express NOX1 regulatory subunits (p22 phox, NOXO1, NOXA1, and RAC1) or co-express these components to ensure functional enzyme assembly.

  • Construct design: Include appropriate tags (His, FLAG, etc.) that don't interfere with functional domains, especially the transmembrane regions or cytosolic subunit interaction sites.

  • Expression verification: Validate expression using multiple methods including Western blot, qPCR, and activity assays.

  • Functional validation: Confirm ROS production capability using methods outlined in FAQ 3.2, comparing to positive controls (like PMA-stimulated neutrophils for NOX2) and negative controls.

  • Subcellular localization: Verify proper membrane localization using fractionation studies or imaging techniques, as mislocalized NOX1 may not form functional complexes.

  • Regulatory subunit co-expression: Ensure appropriate levels of all necessary components (p22 phox, NOXO1, NOXA1, RAC1) for complete functional assembly.

  • Inducible systems: Consider tetracycline-inducible or similar systems to control expression levels and timing, especially if constitutive NOX1 activity might affect cell viability.

How does NOX1 contribute to cancer development and progression?

NOX1 has multiple roles in cancer development and progression:

  • Cellular transformation: Overexpression of NOX1 in NIH3T3 cells has been shown to increase superoxide generation, promote cell growth, lead to transformed appearance, demonstrate anchorage-independent growth, and produce tumors in athymic mice .

  • Proliferation signaling: NOX1-derived ROS can activate various signaling pathways that promote cancer cell proliferation, including MAPK/ERK signaling.

  • Migration and invasion: NOX1 can modulate Rho GTPase activity, disrupting actin stress fibers and focal adhesions, potentially contributing to the migratory and invasive capacity of cancer cells. In K-Ras-transformed kidney fibroblast cells, NOX1-generated oxidants downregulate Rho activity through inactivation of protein-tyrosine phosphatase .

  • Resistance to apoptosis: NOX1 activation can lead to increased expression of anti-apoptotic factors like Bcl-xl, as observed in intestinal epithelial cells responding to IL-13 .

  • Altered differentiation: NOX1 can render keratinocytes resistant to differentiation signals and promote expression of markers associated with malignant progression, such as vimentin and K8/K18 .

  • Angiogenesis promotion: NOX1 may be involved in VEGF signaling in endothelial cells, contributing to tumor angiogenesis .

NOX1 is overexpressed in colon cancer samples and cancer cell lines (Caco2, HT29, T84) as well as human melanoma cell lines , making it a potential target for cancer therapeutics.

What is the role of NOX1 in inflammatory disorders and wound healing?

NOX1 has dual roles in inflammation and wound healing:

In inflammatory responses:

  • NOX1 and its derived ROS respond to inflammatory cytokines like IL-13 and Interferon-γ in intestinal epithelial cells .

  • NOX1-derived ROS can regulate the expression of inflammatory mediators and cytokines.

  • NOX1 forms a complex with TRADD, RIP1, and RAC1 in response to TNF-α, generating superoxide in murine fibrosarcoma L929 cells and MEF cells .

In wound healing:

  • NOX1-derived ROS promote epithelial cell migration and proliferation, critical for reepithelialization .

  • In response to growth factors like HGF, NOX1 enhances keratinocyte migration .

  • NOX1 regulates ERK1/2 and STAT6 phosphorylation in response to IL-13, increasing expression of intestinal trefoil factor 3 (TFF3), which contributes to epithelial restitution and wound healing .

  • NOX1 participates in fibroblast activity, potentially regulating extracellular matrix production.

How is NOX1 implicated in cardiovascular pathologies?

NOX1 contributes to cardiovascular pathologies through several mechanisms:

  • Endothelial dysfunction: NOX1-derived ROS can reduce nitric oxide bioavailability by promoting its conversion to peroxynitrite, impairing endothelium-dependent vasodilation.

  • Vascular smooth muscle cell proliferation: NOX1 is expressed in vascular smooth muscle cells and can promote their proliferation and migration, contributing to vascular remodeling and atherosclerosis development .

  • Atherosclerotic plaque formation: NOX1-derived ROS contribute to oxidative modification of LDL, foam cell formation, and inflammatory responses in the vessel wall.

  • Hypertension: NOX1 activation can lead to increased vascular resistance through effects on smooth muscle contraction and vascular remodeling.

  • Angiogenesis: NOX1 may be involved in VEGF signaling in activated sinusoidal endothelial cells, potentially contributing to pathological angiogenesis .

  • Ischemia-reperfusion injury: NOX1, along with other NOX family members, contributes to oxidative damage during reperfusion following ischemic events .

These mechanisms make NOX1 a potential therapeutic target for cardiovascular diseases, with inhibition possibly offering benefits in conditions like atherosclerosis, hypertension, and ischemia-reperfusion injury.

What are the current challenges in developing selective NOX1 inhibitors for therapeutic applications?

Developing selective NOX1 inhibitors faces several challenges:

  • Structural similarity within the NOX family: NOX1 shares significant sequence homology with other NOX isoforms, particularly NOX2 (approximately 60% sequence identity), making selective targeting difficult .

  • Limited structural information: Despite advances, detailed crystal structures of NOX1 in complex with inhibitors remain limited, hampering structure-based drug design.

  • Complex activation mechanisms: NOX1 activation involves multiple protein-protein interactions and regulatory subunits, creating challenges in identifying which interactions to target for maximum efficacy .

  • Physiological roles: NOX1 plays important physiological roles in certain tissues, raising concerns about potential side effects from complete inhibition.

  • Oxidative stress paradox: Some level of ROS signaling is essential for normal cell function, including wound healing and immune responses, so completely blocking NOX1 may have unintended consequences .

  • Bioavailability issues: Many current NOX inhibitors have poor pharmacokinetic properties, limiting their in vivo effectiveness.

  • Specificity validation: Convincingly demonstrating NOX1 selectivity requires appropriate assays and controls that are not standardized across the field .

These challenges have thus far precluded a definitive pharmacologic demonstration of NOX1 as a therapeutic target in vivo , despite its promising involvement in various pathological conditions.

How do post-translational modifications regulate NOX1 activity and what are their implications for disease pathogenesis?

Post-translational modifications (PTMs) of NOX1 and its regulatory subunits significantly impact enzyme activity and function:

  • Phosphorylation: While less studied than for NOX2, phosphorylation of NOX1 or its regulatory subunits likely affects complex assembly and activity. For example, phosphorylation of NOXO1 may alter its interaction with NOX1 or membrane phospholipids.

  • S-glutathionylation: Oxidative modifications like S-glutathionylation could affect NOX1 structure and function, potentially creating feedback regulation under oxidative stress conditions.

  • Ubiquitination: May regulate NOX1 protein turnover and degradation, affecting the duration of ROS signaling responses.

  • Glycosylation: Could influence NOX1 folding, trafficking to membranes, and protein stability.

  • Protein-protein interactions: RAC1 activation state (GDP versus GTP-bound) critically regulates NOX1 activity . The GTP-bound form creates a higher affinity conformation that enhances NOX1 function.

Understanding these PTMs has significant implications:

  • They may represent intervention points for therapeutic targeting with greater specificity than catalytic site inhibitors

  • Alterations in PTM patterns may contribute to disease pathogenesis

  • They could explain tissue-specific differences in NOX1 activity

  • They may facilitate development of biomarkers for NOX1 hyperactivation in disease states

Research methodologies combining mass spectrometry, site-directed mutagenesis, and activity assays are needed to fully characterize NOX1 PTMs and their functional consequences.

What are the mechanisms of cross-talk between NOX1 and other ROS-generating systems in complex disease settings?

NOX1 engages in sophisticated cross-talk with other ROS-generating systems:

  • Mitochondrial ROS interactions: NOX1-derived ROS can damage mitochondria, leading to increased mitochondrial ROS production, creating a positive feedback loop. Conversely, mitochondrial ROS can activate NOX1 through redox-sensitive signaling pathways.

  • NOS systems interplay: NOX1 can uncouple nitric oxide synthase (NOS) through BH4 oxidation, shifting NOS from NO production to superoxide generation. In diabetic conditions, NOX1 interacts with inducible NOS (iNOS) to increase expression of TGF-β and fibronectin, contributing to kidney fibrogenesis .

  • Other NOX isoforms: NOX1 can influence the expression of other NOX family members. For example, NOX1 can induce the increased expression of NOX4 and DUOX2 in IL-13 treated intestinal epithelial cells .

  • Xanthine oxidase: NOX1 activation may increase xanthine oxidase activity through redox-sensitive pathways, amplifying ROS production.

  • Cyclooxygenases and lipoxygenases: NOX1 can activate these enzymes, which in turn produce reactive lipid species that further modulate redox signaling. NOX1 mediates UVA-initiated prostaglandin E2 (PGE2) synthesis in keratinocytes .

  • Peroxisomes: Cross-talk between NOX1 and peroxisomal ROS metabolism may influence cellular redox balance.

In complex disease settings like diabetes, atherosclerosis, and cancer, these interactions create redox signaling networks that collectively determine cellular phenotype and disease progression. Understanding these interactions is critical for developing effective therapeutic strategies that target the most appropriate nodes in the network rather than individual enzymes in isolation.

What role does NOX1 play in the tumor microenvironment and cancer cell immune evasion?

NOX1 has emerging roles in shaping the tumor microenvironment and facilitating immune evasion:

  • Immunosuppressive ROS production: NOX1-derived ROS can suppress T-cell activation and function, creating a local immunosuppressive environment that protects cancer cells from immune surveillance.

  • Tumor-associated macrophage polarization: NOX1-generated ROS may influence macrophage polarization toward an M2 (tumor-promoting) phenotype rather than an M1 (tumor-suppressing) phenotype.

  • Cancer-associated fibroblast activation: NOX1 potentially contributes to the activation of fibroblasts in the tumor stroma, promoting extracellular matrix remodeling and creating a supportive environment for cancer progression. NOX1 overexpression in NIH3T3 fibroblasts leads to a transformed appearance and tumorigenic potential .

  • Angiogenesis regulation: NOX1 may be involved in the regulation of angiogenic factors like VEGF, promoting new blood vessel formation to support tumor growth. NOX1 expression was found to be increased in activated sinusoidal endothelial cells transformed by constitutively activated VEGFR1 kinase .

  • PD-L1 expression modulation: Emerging evidence suggests ROS can regulate the expression of immune checkpoint molecules like PD-L1, potentially contributing to cancer cell immune evasion.

  • Inflammatory cytokine production: NOX1-dependent ROS can modulate the production of inflammatory cytokines, creating a chronic inflammatory environment that supports tumor progression while suppressing effective anti-tumor immunity.

Understanding these mechanisms could lead to novel therapeutic approaches combining NOX1 inhibition with immunotherapies to enhance anti-tumor immune responses and overcome resistance to current immunotherapeutic approaches.

What are the key considerations for validating NOX1 antibody specificity in research applications?

Validating NOX1 antibody specificity is critical for reliable research outcomes:

  • Positive controls: Test antibodies in systems with confirmed NOX1 overexpression, such as stably transfected cell lines .

  • Negative controls: Validate using NOX1 knockout systems or cells known not to express NOX1. CRISPR/Cas9-generated NOX1 knockouts provide ideal negative controls .

  • Cross-reactivity assessment: Test against other NOX family members, particularly NOX2, which shares approximately 60% sequence identity with NOX1 , to ensure specificity.

  • Multiple detection methods: Confirm specificity using different techniques (Western blot, immunofluorescence, flow cytometry) as antibodies may perform differently across applications .

  • Peptide competition: Perform peptide competition assays with the immunizing peptide to confirm binding specificity.

  • Antibody validation table: Document validation results systematically, including:

Validation MethodPositive Control ResultsNegative Control ResultsCross-reactivity
Western blotBand at expected MWNo band in NOX1 KONo bands for other NOX proteins
ImmunofluorescenceMembrane localizationNo signal in NOX1 KONo signal in cells expressing other NOX proteins
Flow cytometryPositive signal shiftNo shift in NOX1 KONo shift in cells expressing other NOX proteins
  • Multiple antibodies: Where possible, confirm key findings using different antibodies targeting distinct NOX1 epitopes.

  • siRNA validation: Confirm specificity through signal reduction following NOX1-targeted siRNA treatment .

This rigorous validation is essential as the literature contains studies using inadequately characterized antibodies, potentially leading to contradictory findings regarding NOX1 expression and function.

How can researchers effectively differentiate between NOX1 and other NOX family members in functional studies?

Differentiating between NOX1 and other NOX family members requires a multi-faceted approach:

  • Genetic manipulation strategies:

    • siRNA/shRNA with validated specificity for NOX1 mRNA

    • CRISPR/Cas9-mediated NOX1 knockout

    • Reconstitution experiments in knockout systems with wild-type or mutant NOX1

  • Pharmacological approaches:

    • Use of relatively selective NOX1 inhibitors with appropriate controls

    • Comparative inhibition studies with isoform-selective compounds

    • Dose-response relationships to identify differential sensitivity

  • Expression analysis:

    • Quantitative PCR with validated isoform-specific primers

    • Western blot with validated antibodies against different NOX isoforms

    • Single-cell RNA-seq to identify cell populations expressing specific NOX isoforms

  • Functional characteristics:

    • Analysis of subcellular localization patterns characteristic of different NOX isoforms

    • Evaluation of response to stimuli that differentially activate NOX isoforms

    • Assessment of ROS production kinetics and species generated (superoxide vs. hydrogen peroxide)

  • Regulatory subunit dependence:

    • Analysis of requirement for specific regulatory subunits (NOXO1/NOXA1 for NOX1 vs. p47phox/p67phox for NOX2)

    • Co-immunoprecipitation studies to identify interacting partners

    • Reconstitution studies with specific regulatory subunits

  • Tissue/cell type context:

    • Consideration of known expression patterns of NOX isoforms in specific tissues

    • Use of cell types with predominant expression of particular NOX isoforms

By combining these approaches, researchers can more confidently attribute observed effects to NOX1 rather than other NOX family members, enhancing the specificity and translational relevance of their findings.

What experimental controls are essential when studying the role of NOX1-derived ROS in cell signaling pathways?

Essential experimental controls for studying NOX1-derived ROS in signaling include:

  • Genetic controls:

    • NOX1 knockdown/knockout cells compared to appropriate wild-type controls

    • Rescue experiments with wild-type NOX1 in knockout cells

    • Catalytically inactive NOX1 mutants to distinguish enzymatic from scaffolding functions

  • Pharmacological controls:

    • NOX1 inhibitors at validated selective concentrations

    • General antioxidants (NAC, catalase) to confirm ROS dependence

    • Specific ROS scavengers (e.g., superoxide dismutase for superoxide) to identify relevant species

    • Inhibitors of other ROS sources (e.g., mitochondrial inhibitors, XO inhibitors) to exclude their contribution

  • Spatiotemporal controls:

    • Time-course experiments to establish causality in signaling cascades

    • Subcellular fractionation or targeted ROS probes to determine compartmentalization of ROS signals

    • Acute vs. chronic NOX1 modulation to distinguish adaptive responses

  • Dose-response relationships:

    • Titration of stimuli to identify physiological vs. pathological responses

    • Correlation between measured ROS levels and downstream signaling events

  • Parallel pathway analysis:

    • Examination of multiple downstream targets to establish specificity

    • Inhibitors of parallel signaling pathways to identify cross-talk

  • Validation in multiple cell types:

    • Confirmation in primary cells in addition to cell lines

    • Comparison between cells with different baseline NOX1 expression levels

  • In vivo confirmation:

    • Verification of key findings in tissue-specific NOX1 knockout models

    • Comparison between acute and chronic NOX1 modulation in vivo

  • Technical controls:

    • Multiple independent ROS detection methods

    • Positive controls for ROS detection reagents (e.g., exogenous H₂O₂)

    • Vehicle controls for all treatments

    • Controls for potential artifacts in ROS measurement (e.g., probe auto-oxidation)

These controls help establish the specificity, physiological relevance, and mechanistic basis of NOX1-mediated signaling, distinguishing it from effects of other ROS sources or non-specific experimental artifacts.

What are promising approaches for developing NOX1-specific inhibitors with improved selectivity?

Promising approaches for developing selective NOX1 inhibitors include:

  • Structure-based drug design:

    • Targeting unique binding pockets identified through comparative structural analysis of NOX isoforms

    • Focusing on regions of NOX1 that interact with its specific regulatory subunits NOXO1 and NOXA1, rather than the catalytic core shared with other NOX enzymes

    • Developing allosteric modulators that bind to regions with lower sequence conservation

  • Regulatory subunit targeting:

    • Developing compounds that interfere with NOX1-NOXO1 or NOX1-NOXA1 interactions

    • Targeting the RAC1 interaction with NOX1 or NOXA1, which is critical for NOX1 activation

    • Designing peptide-based inhibitors mimicking critical interaction domains

  • Combination approaches:

    • Creating bifunctional molecules that simultaneously target NOX1 and its specific regulatory components

    • Developing tissue-targeted delivery systems to concentrate inhibitors in tissues with high NOX1 expression (e.g., colon, vasculature)

  • High-throughput screening innovations:

    • Cell-based assays using NOX1-specific readouts rather than general ROS production

    • Comparative screening against multiple NOX isoforms simultaneously to identify selective hits

    • Fragment-based screening to identify novel chemical scaffolds with isoform selectivity potential

  • Natural product exploration:

    • Investigating natural compounds with reported NOX inhibitory activity for NOX1 selectivity

    • Structure-activity relationship studies to enhance selectivity of promising natural scaffolds

  • Targeted degradation approaches:

    • Developing NOX1-directed PROTACs (proteolysis targeting chimeras) or molecular glues

    • Exploiting the ubiquitin-proteasome system to achieve isoform-selective degradation

This multi-faceted approach is necessary as identification of selective NOX inhibitors remains challenging, precluding definitive pharmacologic demonstration of NOX as therapeutic targets in vivo .

How might single-cell analysis technologies advance our understanding of NOX1 in heterogeneous tissues?

Single-cell analysis technologies offer transformative potential for NOX1 research:

  • Single-cell RNA sequencing:

    • Identifying previously unrecognized cell populations expressing NOX1

    • Characterizing co-expression patterns of NOX1 with its regulatory subunits and downstream targets

    • Mapping NOX1 expression changes during disease progression at cellular resolution

    • Revealing compensatory expression of other NOX isoforms in specific cell populations

  • Single-cell proteomics:

    • Quantifying NOX1 protein levels in rare cell populations

    • Correlating NOX1 protein with activation state of signaling pathways

    • Detecting post-translational modifications of NOX1 in specific cell types

  • Spatial transcriptomics and proteomics:

    • Mapping NOX1 expression in the spatial context of tissues

    • Identifying microenvironmental factors influencing NOX1 expression

    • Visualizing NOX1 expression in relation to disease features (e.g., tumor margins, inflammatory foci)

  • Mass cytometry (CyTOF):

    • Simultaneous measurement of NOX1 with multiple signaling markers

    • Tracking NOX1 expression in immune cell subsets during inflammatory responses

    • Correlating NOX1 levels with cellular phenotypes

  • Live-cell imaging of ROS at single-cell resolution:

    • Visualizing heterogeneity in NOX1-derived ROS production

    • Correlating ROS dynamics with cellular behaviors (migration, proliferation)

    • Identifying cell-cell communication mediated by NOX1-derived ROS

  • Single-cell ATAC-seq:

    • Characterizing chromatin accessibility at the NOX1 locus in different cell types

    • Identifying cell type-specific regulatory elements controlling NOX1 expression

    • Discovering transcription factor networks regulating NOX1 in specific cellular contexts

These technologies could reveal how NOX1 contributes to disease heterogeneity, identify new therapeutic targets in NOX1-expressing cell populations, and enable precision medicine approaches targeting specific cellular contexts where NOX1 drives pathology.

What is the potential significance of NOX1 splice variants and their differential expression in health and disease?

NOX1 splice variants represent an underexplored dimension of NADPH oxidase biology with potential significance:

  • Functional diversity:

    • Different splice variants may exhibit altered catalytic activity, regulation, or subcellular localization

    • Variants lacking certain domains might act as natural dominant-negatives, regulating full-length NOX1 activity

    • Some variants might interact preferentially with specific regulatory subunits or signaling partners

  • Tissue-specific expression patterns:

    • Different splice variants may show tissue-specific expression, contributing to specialized functions

    • Developmental regulation of splice variant expression could control ROS-dependent developmental processes

    • Disease-specific shifts in splicing patterns might contribute to pathological ROS production

  • Therapeutic targeting opportunities:

    • Splice variant-specific inhibition could provide higher selectivity than targeting all NOX1 forms

    • Modulation of splicing machinery to favor expression of less active NOX1 variants could offer therapeutic benefit

    • Variant-specific antibodies could enable more precise diagnostic and monitoring approaches

  • Biomarker potential:

    • Specific splice variants might serve as biomarkers for disease subtypes or progression

    • Ratio of different NOX1 splice variants could indicate disease activity or therapeutic response

    • Circulating RNA from specific variants might enable liquid biopsy approaches

  • Evolutionary considerations:

    • Comparative analysis of NOX1 splice variants across species could reveal evolutionarily conserved functional domains

    • Species-specific splicing patterns might explain differences in disease models between humans and experimental animals

Research methodologies combining isoform-specific qPCR, RNA-seq with splice junction analysis, and recombinant expression of specific variants would advance understanding of this dimension of NOX1 biology and potentially reveal new therapeutic opportunities.

How can NOX1 expression or activity be effectively measured in clinical samples for biomarker development?

Effective measurement of NOX1 in clinical samples requires standardized methodologies:

  • Tissue biopsy analysis:

    • Immunohistochemistry using validated antibodies with appropriate controls

    • RNA in situ hybridization for NOX1 mRNA detection

    • Laser capture microdissection coupled with qPCR or proteomics to analyze specific cell populations

    • Digital pathology with quantitative image analysis for standardized scoring

  • Blood-based measurements:

    • Analysis of circulating NOX1-positive microvesicles

    • Measurement of NOX1 protein or mRNA in circulating immune cells

    • Detection of NOX1 autoantibodies as potential disease markers

    • Correlation with established oxidative stress markers (e.g., isoprostanes, protein carbonyls)

  • Activity-based assessments:

    • Ex vivo stimulation assays of patient-derived cells to assess NOX1 activation capacity

    • Measurement of specific NOX1-derived oxidation products

    • Luminescence-based activity assays adapted for clinical samples

  • Standardization approaches:

    • Development of reference standards for NOX1 expression and activity

    • Interlaboratory validation studies to ensure reproducibility

    • Establishment of normal range values across different tissues and demographic groups

  • Correlation with clinical parameters:

    • Association studies between NOX1 measurements and disease activity scores

    • Longitudinal analysis to assess predictive value for disease progression or treatment response

    • Multiparameter analysis combining NOX1 with other biomarkers for improved specificity and sensitivity

The development of standardized NOX1 biomarker assays could enable patient stratification for clinical trials of NOX inhibitors, personalized therapy selection, and improved monitoring of disease activity in conditions where NOX1 plays a pathogenic role.

What are the most promising therapeutic applications for NOX1 inhibitors based on current evidence?

Based on current evidence, the most promising therapeutic applications for NOX1 inhibitors include:

  • Gastrointestinal disorders:

    • Inflammatory bowel diseases (particularly ulcerative colitis), leveraging the high expression of NOX1 in colon epithelium

    • Colorectal cancer, where NOX1 is overexpressed and contributes to cancer cell growth and migration

    • Ischemia-reperfusion injury in the intestine, reducing oxidative damage during reperfusion

  • Cardiovascular diseases:

    • Atherosclerosis, targeting NOX1 in vascular smooth muscle cells and endothelial cells

    • Hypertension, reducing vascular remodeling and improving endothelial function

    • Ischemic heart disease, limiting reperfusion injury after myocardial infarction

  • Dermatological conditions:

    • UV-induced skin damage, blocking NOX1-dependent ROS production in keratinocytes

    • Chronic non-healing wounds, normalizing redox signaling to promote healing

    • Fibrotic skin disorders, targeting NOX1-dependent fibroblast activation

  • Cancer:

    • Colon and small intestinal adenocarcinomas, where NOX1 is overexpressed

    • Combination therapy with immunotherapy, potentially overcoming immune evasion mechanisms

    • Radiation sensitization, enhancing cancer cell killing while protecting normal tissues

  • Fibrotic disorders:

    • Kidney fibrosis in diabetic nephropathy, where NOX1 interactions with iNOS promote fibrogenic factor expression

    • Liver fibrosis, targeting activated hepatic stellate cells

    • Pulmonary fibrosis, reducing oxidative stress-driven fibroblast activation

The development of selective NOX1 inhibitors remains challenging , but these applications represent areas where the strongest mechanistic evidence supports a pathogenic role for NOX1, providing a clear rationale for therapeutic targeting.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.