Recombinant Human NADPH oxidase 5 (NOX5)

Shipped with Ice Packs
In Stock

Description

Structure and Activation of NOX5

Recent studies have elucidated the structural basis of NOX5 activation using cryo-electron microscopy (cryo-EM), revealing how calcium ions (Ca²⁺) trigger its enzymatic activity. The activation process involves changes in the electron transfer pathway and the binding of NADPH to the enzyme's catalytic site . This structural insight is crucial for understanding how NOX5 contributes to oxidative stress in different cellular contexts.

Role of NOX5 in Endothelial Dysfunction

NOX5 overexpression in endothelial cells has been linked to endothelial dysfunction, a precursor to cardiovascular diseases such as atherosclerosis and myocardial infarction. Studies using the hCMEC/D3 cell line have shown that NOX5 promotes apoptosis, inhibits cell proliferation, and alters cellular metabolism, contributing to the atherothrombotic process . These findings suggest that NOX5 may be a key player in the pathogenesis of cardiovascular diseases.

NOX5 in Cancer Progression

In esophageal squamous cell carcinoma (ESCC), NOX5 is significantly upregulated and associated with tumor progression. NOX5-derived ROS can activate local Src, promoting cell growth and invasion under both normoxic and hypoxic conditions. The clinical relevance of NOX5 expression in ESCC is supported by its correlation with advanced tumor stages and poor patient outcomes .

NOX5 in Vascular Function

NOX5 is also implicated in vascular contractility, acting as a pro-contractile NADPH oxidase isoform. It enhances agonist-induced vasoconstriction and impairs endothelium-dependent vasorelaxation, contributing to vascular dysfunction. This role is supported by studies in transgenic mice expressing NOX5 in smooth muscle cells, which exhibit exaggerated vascular contractile responses .

NOX5 in Cardiac Disease

In cardiac disease models, NOX5 exacerbates pressure overload-induced cardiac remodeling and dysfunction by promoting ROS production in response to hypertrophic stress. Its expression is induced in failing human hearts, suggesting a potential therapeutic target for treating cardiac hypertrophy and heart failure .

Table 2: NOX5 Expression and Activity

ConditionNOX5 ExpressionActivity
Normal TissuesLowBasal ROS production
ESCC TumorsHighEnhanced ROS production, tumor progression
Failing HeartsInducedROS-mediated cardiac remodeling

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is finalized during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
NOX5; NADPH oxidase 5
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-765
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
NOX5
Target Protein Sequence
MNTSGDPAQTGPEGCRGTMSAEEDARWLRWVTQQFKTIAGEDGEISLQEFKAALHVKESF FAERFFALFDSDRSGTITLQELQEALTLLIHGSPMDKLKFLFQVYDIDVCARQGASAGTE WGAGAGPHWASSPLGTGSGSIDPDELRTVLQSCLRESAISLPDEKLDQLTLALFESADAD GNGAITFEELRDELQRFPGVMENLTISAAHWLTAPAPRPRPRRPRQLTRAYWHNHRSQLF CLATYAGLHVLLFGLAASAHRDLGASVMVAKGCGQCLNFDCSFIAVLMLRRCLTWLRATW LAQVLPLDQNIQFHQLMGYVVVGLSLVHTVAHTVNFVLQAQAEASPFQFWELLLTTRPGI GWVHGSASPTGVALLLLLLLMFICSSSCIRRSGHFEVFYWTHLSYLLVWLLLIFHGPNFW KWLLVPGILFFLEKAIGLAVSRMAAVCIMEVNLLPSKVTHLLIKRPPFFHYRPGDYLYLN IPTIARYEWHPFTISSAPEQKDTIWLHIRSQGQWTNRLYESFKASDPLGRGSKRLSRSVT MRKSQRSSKGSEILLEKHKFCNIKCYIDGPYGTPTRRIFASEHAVLIGAGIGITPFASIL QSIMYRHQKRKHTCPSCQHSWIEGVQDNMKLHKVDFIWINRDQRSFEWFVSLLTKLEMDQ AEEAQYGRFLELHMYMTSALGKNDMKAIGLQMALDLLANKEKKDSITGLQTRTQPGRPDW SKVFQKVAAEKKGKVQVFFCGSPALAKVLKGHCEKFGFRFFQENF
Uniprot No.

Target Background

Function
Recombinant Human NADPH Oxidase 5 (NOX5) is a calcium-dependent NADPH oxidase that generates superoxide. It also functions as a calcium-dependent proton channel and may regulate redox-dependent processes in lymphocytes and spermatozoa. NOX5 may play a role in cell growth and apoptosis. Isoforms v2 and v5 are involved in endothelial reactive oxygen species (ROS) generation, proliferation, angiogenesis, and endothelial response to thrombin.
Gene References Into Functions
  1. NOX5 downregulation is observed during the development of cisplatin resistance in tumor cells, alongside upregulation of key antioxidant enzymes and the transcription factor Nrf2. PMID: 30225719
  2. Leptin appears to activate ROS production in human mammary epithelial cells, potentially through NOX5 activation. This suggests a possible role for obesity-associated hyperleptinemia in mammary cell function via NOX enzyme activation. PMID: 29048637
  3. Taurodeoxycholic acid-induced DNA damage may involve TGR5, CREB, and NOX5-S activation. NOX5-S-derived ROS could contribute to Barrett's esophagus progression to esophageal adenocarcinoma. PMID: 27511066
  4. NOX5 expression is found in platelets from X-linked chronic granulomatous disease patients at levels comparable to normal platelets. PMID: 26963053
  5. NOX5 expression in melanoma cells may contribute to cell proliferation by generating high local concentrations of extracellular ROS, modulating pathways that regulate HIF-1α and Akt/GSK3β/p27(Kip1) signaling. PMID: 28762556
  6. NOX1 and NOX4 activity, but not NOX5, depend on p22phox. PMID: 27614387
  7. The NOX5-p22phox complex is involved in monocytic differentiation into dendritic cells, suggesting a role in immunity and inflammation. PMID: 28830888
  8. Oxidation of NOX5's calcium-binding domain may be involved in its inactivation, potentially serving as a defense mechanism against oxidative stress. PMID: 27391469
  9. NOX5 activation plays a pathophysiological role in vascular disease. PMID: 28473473
  10. NOX5-L depletion suppresses breast cancer cell proliferation, invasion, and migration in vitro, and its expression is regulated by STAT5A. PMID: 28034671
  11. Review of NOX5 genetic and enzymatic regulation, and its role in human physiology and pathophysiology. PMID: 26510438
  12. Rho Kinase ROCK2 mediates acid-induced NOX5-S expression in human esophageal adenocarcinoma cells. PMID: 26901778
  13. NOX5-derived ROS and subsequent depletion of PKCζ and JNK inactivation are critical in modulating signaling cascades involved in prostate cancer cell proliferation and survival. PMID: 25559363
  14. High glucose increases NADPH oxidase activity and expression in human vascular smooth muscle cells. Analysis of human Nox1, Nox4, and Nox5 gene promoters. PMID: 25722086
  15. NOX5α may be a potential molecular target for treating HTLV-1-related leukemia. PMID: 26109726
  16. NOX5-derived ROS contribute to apoptosis blockage in ALK-positive anaplastic large-cell lymphoma cell lines. PMID: 25797883
  17. NOX5 overexpression is observed in several human cancers. PMID: 23851018
  18. Glomerular and tubular expression of Nox5 is induced during diabetes and hypertension. SNPs in human populations suggest a potential role for this enzyme in health and disease. PMID: 25415612
  19. NOX5 is implicated in atherogenesis, with induction of expression in IFNγ- and oxidized LDL-exposed macrophages and presence in atheroma. PMID: 25871798
  20. NOX5 is expressed in human renal proximal tubule cells, at higher levels in hypertensive subjects. PMID: 24688893
  21. NOX4 and NOX5 are involved in radiation-induced DNA damage. PMID: 25706776
  22. PKC-α is the primary isoform mediating NOX5 activation. PMID: 24505490
  23. Podocyte NOX5 plays a significant role in impaired renal function and hypertension. PMID: 24262797
  24. NOX5 is expressed in various regions of human spermatozoa with teratozoospermia. PMID: 23030296
  25. NOX5-S overexpression increases luciferase activity. PMID: 23439561
  26. NO can directly S-nitrosylate and inhibit NOX5 activity. PMID: 22387196
  27. NOX5 is expressed in human intramyocardial blood vessels and cardiomyocytes, with increased expression after acute myocardial infarction. PMID: 22503554
  28. NOX5-α and -β splice variants are the major isoforms expressed in blood vessels and the only ones capable of ROS production. PMID: 22427510
  29. Inhibition of NOX5 activity reduces spermatozoa motility. PMID: 22291013
  30. Review of NOX5 gene, enzyme structure and biochemistry, role in health and disease, and development of NOX inhibitors. PMID: 22182486
  31. Reduced matrigel invasion is associated with reduced ROS levels and decreased expression of NADPH oxidases 2, 3, 4, and 5. PMID: 21901141
  32. Rac1 may be involved in NOX5-S activation in Barrett's esophageal adenocarcinoma cells. PMID: 21525435
  33. MAPK signaling influences NOX5 phosphorylation and activation. PMID: 21297032
  34. NOX5 forms a catalytically active oligomer in the membrane, mediated by its dehydrogenase domain. PMID: 21319793
  35. Effect of pH on p16 and NOX5-S expression in Barrett's esophagus cells and their progression to esophageal adenocarcinoma. PMID: 20576920
  36. Shingosylphosphorylcholine down-regulates FLG gene transcription through NOX5-based NADPH oxidase and COX-2 in human keratinocytes. PMID: 20230798
  37. Endothelial cells have functionally active Nox5 regulated by Ang II and ET-1. PMID: 20339118
  38. Bile acid reflux may increase ROS production and cell proliferation through PI-PLCγ2, ERK2 MAP kinase, and NOX5-S, contributing to esophageal adenocarcinoma development. PMID: 20086178
  39. NOX5 activity in sperm and white blood cell NADPH-oxidase; role of protein kinase C in NOX5 activation. PMID: 12121572
  40. GTP-bound Rac is required for sustained NOX5 activity, and membrane-localized GAPs play a role in deactivation. PMID: 12186557
  41. The regulatory N-terminus and catalytic C-terminus of NOX5 interact in a Ca2+-dependent manner; activation involves an intramolecular interaction. PMID: 14982937
  42. Bacterial phospholipid degradation requires group IIA-phospholipase A2 and a functional NADPH oxidase in neutrophils. PMID: 16177112
  43. Hairy cells express NOX5; NOX5-generated ROS inactivate SHP-1, contributing to constitutive activation of hairy cells. PMID: 16339585
  44. NOX5 knockdown decreases retinoblastoma protein phosphorylation and increases apoptosis and caspase-9 expression. PMID: 16707484
  45. NO down-regulates the gp91(phox)/p47(phox)-containing NAD(P)H oxidase complex in response to shear stress. PMID: 16873416
  46. Chronic granulomatous disease (CGD) is caused by mutations in NADPH oxidase subunits, leading to decreased neutrophil oxidative burst. PMID: 17089090
  47. NADPH oxidase is involved in superoxide release by rheumatoid arthritis synovial cells, constitutively and after cytokine upregulation. PMID: 17122966
  48. NOX5 phosphorylation facilitates enzyme activation at lower calcium levels. PMID: 17164239
  49. NAD(P)H oxidase polymorphism (C242T) is associated with recurrent coronary events in post-infarction patients. PMID: 17214994
  50. Calmodulin binds to the NOX5 C-terminus, altering conformation and increasing Ca2+ sensitivity. PMID: 17346712
Database Links

HGNC: 14874

OMIM: 606572

KEGG: hsa:79400

STRING: 9606.ENSP00000373518

UniGene: Hs.657932

Subcellular Location
Membrane; Multi-pass membrane protein.; [Isoform v2]: Endoplasmic reticulum.; [Isoform v5]: Endoplasmic reticulum.
Tissue Specificity
Mainly expressed in pachytene spermatocytes of testis and in lymphocyte-rich areas of spleen and lymph nodes. Isoform v1 is expressed in spleen. Isoform v2 is expressed in testis. Also detected in ovary, placenta, pancreas, cardiac fibroblasts. Expressed

Q&A

What is the structural organization of NOX5 and how does it differ from other NOX family members?

NOX5 shares the basic structural paradigm with other NOX family members but contains unique features. Like other NOXs, it has six transmembrane domains supporting two heme moieties (mediated by H286, H300, H374, and H387 in NOX5αV1) and a C-terminal region containing FAD and NADPH binding sites .

  • A unique N-terminal extension containing four calcium-binding EF hands organized as two pairs with different calcium affinities

  • Does not require cytosolic or specific accessory proteins for ROS generation

  • Contains a Regulatory EF-hand Binding Domain (REFBD, aa 656-679) in the C-terminal region that restricts enzyme activity

  • Features a zinc-binding motif important for stability and enzymatic activity

The calcium-dependent regulation involves conformational changes where calcium binding to EF hands triggers interaction with the C-terminal REFBD, removing auto-inhibition and facilitating enzyme activation .

Which NOX5 splice variants exist and what are their functional differences?

There are six recognized splice variants of NOX5 (v1-v6 or α-ζ), with varying tissue distributions and functions :

IsoformFunctional StatusPrimary ExpressionNotes
NOX5-αCatalytically activeWidely expressedProduces ROS effectively
NOX5-βCatalytically activeWidely expressedMost studied variant; produces ROS effectively
NOX5-δNot catalytically activeLimited expressionDoes not produce significant ROS
NOX5-γNot catalytically activeLimited expressionDoes not produce significant ROS
NOX5-ε (short)Not catalytically activeVarious tissuesCan suppress ROS production by binding to active isoforms

Interestingly, coexpression of inactive NOX5 variants with active isoforms (α, β) suppresses ROS production, suggesting a potential regulatory mechanism. Coimmunoprecipitation studies have demonstrated that NOX5-β binds the inactive ε variant, which may account for reduced ROS production in cells expressing multiple isoforms .

What is the tissue distribution pattern of NOX5 and how is it altered in disease states?

NOX5 exhibits specific tissue distribution patterns in healthy tissues and shows altered expression in various pathological conditions:

Normal Tissue Distribution:

  • Most strongly expressed in testis, spleen, and lymph nodes

  • Present in vascular cells (endothelial cells, smooth muscle cells)

  • Detected in developing spermatids and spermatocytes but not in mature spermatozoa

  • Present in ovarian interstitial fibroblasts and theca cells

  • Enriched in splenic endothelial cells

Altered Expression in Disease:

  • Significantly upregulated in clinical esophageal squamous cell carcinoma tumors

  • Substantially overexpressed in cancers of prostate, breast, colon, lung, brain, ovary, malignant melanoma, and non-Hodgkin lymphoma

  • Increased expression in human failing hearts

  • Elevated in blood vessels and vascular smooth muscle cells from hypertensive subjects

  • Expression follows a bimodal distribution in hypertensive patients, correlating with disease severity

Tissue microarray analysis has revealed that most non-malignant tissues exhibit negative to weak NOX5 expression, highlighting its potential as a biomarker in pathological conditions .

How is NOX5 enzymatically regulated in cellular environments?

NOX5 activity is regulated through multiple mechanisms:

Calcium-Dependent Regulation:

  • Primary activation occurs through calcium binding to EF hands in the N-terminal domain

  • Ca²⁺ binding triggers conformational change and removal of auto-inhibition

  • EC₅₀ for calcium-dependent activation is approximately 0.71-1.06 μM

Post-Translational Modifications:

  • Phosphorylation: c-Abl phosphorylates NOX5 at Tyr 476/478 sites, enhancing activity

  • Phosphorylation at Ser/Thr residues can enhance calcium sensitivity

  • N-nitrosylation on cysteine residues can reduce oxidase activity

Protein-Protein Interactions:

  • Calmodulin binding near the NADPH site increases calcium sensitivity at low calcium concentrations

  • Heat shock protein 90 (Hsp90) binding stabilizes the dehydrogenase domain and prevents formation of active NOX5 oligomers

  • Pyk2 acts as a scaffold for c-Abl phosphorylation of NOX5

Environmental Factors:

  • Hypoxia enhances NOX5-Pyk2 interaction and promotes NOX5 activity

  • Actin cytoskeleton dynamics significantly influence NOX5 activity; actin effectors (jasplakinolide, cytochalasin D, latrunculin A) can stimulate NOX5-dependent superoxide production

These multiple regulatory mechanisms provide tight control over NOX5 activity and ROS production in different cellular contexts.

What experimental approaches are most effective for measuring NOX5-specific ROS production?

Several approaches have been validated for measuring NOX5-specific ROS production:

WST1-Based Activity Assay:

  • Widely used for quantifying NOX5 activity with high specificity

  • Allows determination of kinetic parameters (Kcat, Km) and inhibitor efficacy (IC₅₀)

  • Protocol: Add 0.27 pmols of NOX5 protein to 1X PBS containing 10 µM CaCl₂, 3 µM EGTA, 1 mM MgCl₂, 0.5 µM FAD, 0.2 mM NADPH, and 0.2 mM WST1

  • Measure absorbance at 438 nm at 30-60 second intervals

  • Calculate superoxide production by converting optical density to formazan using the extinction coefficient 37,000 M⁻¹cm⁻¹

L-012 Luminescence Assay:

  • Highly sensitive for detecting extracellular superoxide

  • Suitable for real-time kinetic measurements

  • Protocol: Grow cells in phenol red-free media, plate in white tissue culture-treated plates with clear bottoms

  • Add L-012 (400 μM) 60 minutes prior to measurement

  • Stimulate NOX5 with ionomycin (0.5-1 μM) or actin effectors

  • Measure luminescence at short intervals (1-10 seconds) for 180-300 seconds

FLIPR Calcium 6 Assay:

  • Useful for simultaneously monitoring calcium changes and correlating with NOX5 activation

  • Important for distinguishing calcium-dependent effects from direct NOX5 activation

Biotin Switch Assay:

  • Detects oxidative modification of proteins due to NOX5 activity

  • Adds biotin tags to reversibly oxidized cysteine residues

  • Followed by streptavidin pull-down and western blot analysis

For validation of NOX5-specific effects, researchers should include:

  • NOX5 silencing using siRNA as negative control

  • Diphenyleneiodonium (DPI) inhibition (IC₅₀ ≈ 53.45 nM)

  • Testing in cells lacking endogenous NOX5 expression

How can researchers overcome the absence of NOX5 in rodent models for in vivo studies?

The absence of NOX5 in rodents presents a significant challenge for in vivo studies. Researchers have developed several strategies to address this limitation:

Human NOX5 Knock-in (KI) Mouse Models:

  • Tissue-specific expression of human NOX5 in mice using targeted promoters

  • Endothelial-specific NOX5 expression has been achieved using appropriate promoters

  • These models develop age-related systolic hypertension and impaired endothelium-dependent vasodilation, recapitulating human phenotypes

Experimental Design Considerations:

  • Aging studies are crucial: NOX5 knock-in mice develop phenotypes (particularly hypertension) only upon aging, indicating time-dependent effects

  • Regional selectivity assessment: NOX5 effects can be tissue-specific; ex vivo studies of different vascular beds are recommended

  • Measurement parameters: Focus on systolic blood pressure changes, as diastolic pressure may not be significantly affected

Validation of NOX5 Expression:

  • Monitor NOX5 expression levels using qPCR and western blot

  • Protocol example: Real-time RT-PCR performed on 384-well plates in 20-µl reaction system containing 2 µl of diluted cDNA, 1 µl of appropriate primer, 7 µl of H₂O, and 10 µl of TaqMan 2X gene expression master mix reagent

  • Calculate relative gene expression as the ratio of NOX5 to β-actin multiplied by 10⁶ based on Ct values

Alternative Approaches:

  • Xenograft models using human cell lines with modulated NOX5 expression

  • Subcutaneous xenograft and lung colonization models have been validated for NOX5 studies

  • Tumor growth, proliferation index (Ki-67), and microvascular density (CD31) can be assessed by IHC analysis

What are the molecular mechanisms by which NOX5 contributes to cardiovascular pathologies?

NOX5 contributes to cardiovascular pathologies through several coordinated molecular mechanisms:

Endothelial NOS Uncoupling:

  • NOX5-derived ROS cause uncoupling of endothelial nitric oxide synthase (eNOS)

  • This leads to reduced NO bioavailability and impaired endothelium-dependent vasodilation

  • Affects primarily medium-sized muscular conduit arteries

  • Results in selective elevation of systolic arterial blood pressure with aging

Vascular Smooth Muscle Cell (VSMC) Dysfunction:

  • NOX5 expression is significantly increased in VSMCs from hypertensive subjects

  • Serves as the predominant NOX isoform mediating Angiotensin II-stimulated ROS production

  • NOX5 activates Src kinase through local H₂O₂ production

  • The NOX5-Src axis promotes VSMC growth, proliferation, and invasion

Cardiac Remodeling:

  • NOX5 is significantly induced in human failing hearts

  • Exacerbates left ventricular hypertrophy, fibrosis, and dysfunction

  • Acts as a point of cross-talk between intracellular calcium and ROS production

  • Activates MAPK (mitogen-activated protein kinase) pathways contributing to cardiac hypertrophy

Endothelial Dysfunction:

  • NOX5 overexpression in endothelial cells leads to:

    • Inhibition of proliferation and promotion of apoptosis

    • Metabolic alterations

    • Enhanced cell migration

    • Mitochondrial dysfunction

  • These phenotypic changes precede atherosclerosis, myocardial infarction, and stroke

Therapeutic approaches targeting these mechanisms include:

  • Sepiapterin (H₄Bpi precursor) for NOS recoupling

  • NOX5-specific inhibitors (under development)

  • Targeting NOX5-Src interactions (e.g., with dasatinib)

What structural insights from recent cryo-EM studies inform NOX5 activation mechanisms?

Recent cryo-EM studies have provided significant insights into NOX5 structure and activation:

Key Structural Features:

  • Full-length human NOX5 has been captured in multiple states: pre-reaction (NADPH-bound without Ca²⁺), intermediate (with NADPH and Ca²⁺), and post-reaction (with NADP⁺ and Ca²⁺)

  • Resolution of 3.2-4.1 Å has been achieved, revealing detailed molecular architecture

  • Discovered a previously unknown zinc-binding motif critical for NOX5 stability and enzymatic activity

Activation Mechanism:

  • Calcium binding to the EF-hand domain increases NADPH dynamics

  • This enhanced NADPH mobility permits electron transfer between NADPH and FAD

  • Electrons are subsequently transferred through the heme groups to produce superoxide

Methodological Advances:

  • Focused refinement with symmetry expansion improved resolution of cytosolic domains

  • Molecular dynamics (MD) simulations complemented structural data to decode electron transfer mechanisms

  • Combined approach of biochemistry, mutagenesis, and computational methods provided comprehensive understanding

Practical Applications:

  • These structural insights enable rational design of NOX5-specific inhibitors

  • The zinc-binding motif represents a potential novel target for modulating NOX5 activity

  • Understanding NADPH dynamics provides new approaches to interfere with electron transfer process

The structural data also revealed that NOX5 can exist in different oligomeric states, which may affect its activity and regulation in cellular contexts .

How does NOX5 interact with the actin cytoskeleton and what are the functional implications?

Recent research has revealed significant functional interactions between NOX5 and the actin cytoskeleton:

Bidirectional Relationship:

  • Actin cytoskeleton changes directly modulate NOX5 activity

  • NOX5-derived ROS cause oxidative modifications of actin proteins

Actin Regulation of NOX5:

  • Three actin-modifying compounds with divergent effects (jasplakinolide, cytochalasin D, latrunculin A) all stimulate NOX5-dependent superoxide production

  • This stimulation occurs independently of calcium changes, suggesting a direct mechanism

  • Proximity Ligation Assays (PLA) demonstrate close association (<40 nm) between NOX5 and β-actin

NOX5 Effects on Actin:

  • NOX5 activation leads to increased oxidative modification of actin

  • Changes the F/G actin ratio in cells

  • NOX5 knockdown by siRNA decreases cell migration in NOX5-expressing cancer cells

Experimental Approaches:

  • Proximity Ligation Assay Protocol:

    • Use primary antibodies to β-actin (1:1000) and NOX5 (1:1000)

    • Apply oligonucleotide-labeled secondary antibodies

    • Detect signals by fluorescence microscopy (excitation/emission: 594/624 for red signal)

  • F/G Actin Ratio Measurement:

    • Cell lysis in F-actin stabilization buffer

    • Ultracentrifugation to separate F-actin (pellet) from G-actin (supernatant)

    • Western blot analysis of fractions

  • Migration Assays:

    • Scratch assay with NOX5 knockdown cells

    • Monitor wound confluence over time

    • Correlate migration with NOX5 expression levels

These findings suggest that NOX5 may regulate cell migration through its effects on the actin cytoskeleton, explaining its role in cancer progression and vascular remodeling. The NOX5-actin interaction represents a potential therapeutic target for conditions characterized by aberrant cell migration.

What methodological approaches are most effective for detecting and quantifying NOX5 protein expression in clinical samples?

Detecting NOX5 in clinical samples presents unique challenges. The following methodological approaches have proven effective:

Antibody-Based Detection:

  • Recently developed monoclonal antibodies show high specificity for NOX5

  • A validated mouse monoclonal antibody against recombinant NOX5 protein (residues 600-746) has been characterized for multiple applications

Western Blot Protocol:

  • Optimal for quantitative analysis of NOX5 expression

  • Protein extraction should include membrane fraction isolation

  • Use validated antibodies at appropriate dilutions (e.g., 1:1000)

  • Include positive controls (recombinant NOX5) and negative controls (tissues/cells lacking NOX5)

Immunohistochemistry/Immunocytochemistry:

  • Effective for determining cellular and subcellular localization

  • NOX5 typically shows perinuclear enhancement with distribution throughout cells

  • Appropriate tissue processing is critical - standard formalin fixation and paraffin embedding

  • Antigen retrieval methods significantly impact detection sensitivity

Tissue Microarray Analysis:

  • Powerful for screening multiple samples simultaneously

  • Enables comparative analysis across tissue types and disease states

  • Has revealed substantial NOX5 overexpression in several human cancers compared to non-malignant tissues

Endothelial Microparticle Analysis:

  • Novel approach for NOX5 detection in hypertensive patients

  • Isolation of microparticles from plasma by differential centrifugation

  • NOX5 levels in microparticles correlate with disease severity

  • Shows bimodal distribution pattern in hypertensive populations

Combined RNA/Protein Analysis:

  • Integration of single-cell RNA sequencing with protein detection

  • Validates expression patterns and cellular specificity

  • Has confirmed NOX5 expression in specific cell types like spermatogenic cells and ovarian interstitial fibroblasts

For clinical applications, researchers should consider:

  • Including both diseased and matched control tissues

  • Correlating NOX5 expression with clinical parameters

  • Using multiple detection methods for validation

What are the emerging strategies for designing and validating NOX5-specific inhibitors?

The development of NOX5-specific inhibitors has accelerated with recent structural insights:

Rational Design Approaches:

  • Structure-based design utilizing cryo-EM data of human NOX5

  • Focus on unique structural features like:

    • The calcium-binding EF hands domain

    • The regulatory EF-hand binding domain (REFBD)

    • The zinc-binding motif discovered in recent studies

    • The interface between calcium-bound N-terminus and C-terminal region

High-Throughput Screening Strategies:

  • Cell-based assays using NOX5-expressing cells and L-012 luminescence

  • Target-based assays with recombinant NOX5 protein and WST1 detection

  • Fragment-based approaches identifying small molecules that bind to specific NOX5 domains

Validation Protocols:

  • Specificity Testing:

    • Compare effects on NOX5 vs. other NOX isoforms

    • Test in cells expressing single NOX isoforms

    • Assess impact on non-NOX ROS sources (mitochondria, xanthine oxidase)

  • Enzymatic Assays:

    • Determine IC₅₀ values using the WST1-based activity assay

    • Positive control: diphenyleneiodonium (DPI) with known IC₅₀ of ~53.45 nM

    • Assess effects across a range of calcium concentrations

  • Mechanistic Evaluation:

    • Determine whether compounds affect:

      • Calcium binding to EF hands

      • Conformational changes

      • Electron transfer from NADPH to FAD

      • Enzyme oligomerization

Current Challenges:

  • Achieving selectivity among NOX isoforms remains difficult

  • Need for compounds that can cross biological barriers (cell membrane, BBB)

  • Balancing potency with favorable pharmacokinetic properties

  • Limited in vivo testing options due to absence of NOX5 in rodents

Future directions include development of allosteric modulators targeting NOX5-specific regulatory mechanisms and combination approaches that target multiple aspects of NOX5 regulation simultaneously.

How does NOX5 contribute to cancer progression and what therapeutic implications does this have?

NOX5 plays multifaceted roles in cancer progression through several mechanisms:

Expression Pattern in Cancers:

  • Substantially overexpressed in cancers of prostate, breast, colon, lung, brain, ovary

  • High expression in malignant melanoma and non-Hodgkin lymphoma

  • Elevated in esophageal squamous cell carcinoma (ESCC)

Molecular Mechanisms:

  • NOX5-Src Signaling Axis:

    • Under hypoxic conditions, NOX5 interacts with Pyk2

    • Pyk2 acts as a scaffold for c-Abl phosphorylating NOX5 at Tyr 476/478 sites

    • Activated NOX5 produces H₂O₂ that oxidizes and activates local Src

    • This promotes cancer cell growth, invasion, and angiogenesis

  • Cell Migration Regulation:

    • NOX5 modifies actin cytoskeleton through oxidation

    • NOX5 knockdown decreases cancer cell migration

    • This may contribute to metastatic potential

  • Angiogenesis Promotion:

    • NOX5-overexpressing tumors display higher CD31 microvascular density

    • This supports tumor growth through enhanced blood supply

Experimental Evidence:

  • In vitro: NOX5 overexpression in ESCC cells significantly increases growth rates and invasive ability

  • In vivo: Tumors derived from NOX5-overexpressing cells grow faster in xenograft models

  • Metastasis: NOX5 expression increases lung colonization in tail vein injection models

Quantitative Data:

  • Ki-67 proliferation index significantly higher in NOX5-overexpressing tumors

  • Lung metastatic nodules increase proportionally with NOX5 expression level

  • Dasatinib (Src inhibitor) attenuates NOX5-promoted cancer progression

Therapeutic Implications:

  • Direct NOX5 Inhibition:

    • Development of specific NOX5 inhibitors may target cancer cells while sparing normal tissues with low NOX5 expression

  • Targeting Downstream Pathways:

    • Src inhibitors (dasatinib, PP2) effectively attenuate NOX5-promoted cancer progression

    • May be particularly effective in hypoxic tumor regions where NOX5-Src signaling is enhanced

  • Combination Approaches:

    • Combining NOX5 inhibitors with conventional chemotherapy

    • Targeting both NOX5 and hypoxia-related pathways

  • Biomarker Applications:

    • NOX5 expression levels could serve as prognostic markers

    • May help identify patients who would benefit from NOX5-targeted therapies

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.