Recombinant Human NEDD4 family-interacting protein 1 (NDFIP1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify any format requirements in your order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to concentrate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
NDFIP1; N4WBP5; PSEC0192; PSEC0223; NEDD4 family-interacting protein 1; Breast cancer-associated protein SGA-1M; NEDD4 WW domain-binding protein 5; Putative MAPK-activating protein PM13; Putative NF-kappa-B-activating protein 164; Putative NFKB and MAPK-activating protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-221
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
NDFIP1
Target Protein Sequence
MALALAALAAVEPACGSRYQQLQNEEESGEPEQAAGDAPPPYSSISAESAAYFDYKDESG FPKPPSYNVATTLPSYDEAERTKAEATIPLVPGRDEDFVGRDDFDDADQLRIGNDGIFML TFFMAFLFNWIGFFLSFCLTTSAAGRYGAISGFGLSLIKWILIVRFSTYFPGYFDGQYWL WWVFLVLGFLLFLRGFINYAKVRKMPETFSNLPRTRVLFIY
Uniprot No.

Target Background

Function

NDFIP1 activates HECT domain-containing E3 ubiquitin-protein ligases, including NEDD4 and ITCH, modulating the stability of their targets and influencing numerous cellular processes. Its functions include:

  • Anti-inflammation: Prevents chronic T-helper cell-mediated inflammation by activating ITCH, thereby controlling JUNB degradation.
  • Pancreatic beta-cell regulation: Promotes pancreatic beta-cell death by degrading JUNB and inhibiting the unfolded protein response, reducing insulin secretion.
  • Immune response modulation: Restricts proinflammatory cytokine production in effector Th17 T-cells via ITCH-mediated ubiquitination and degradation of RORC. In collaboration with NDFIP2, it limits cytokine signaling and effector Th2 T-cell expansion by promoting JAK1 degradation, likely through ITCH- and NEDD4L-mediated ubiquitination.
  • T-cell tolerance: Regulates peripheral T-cell tolerance to self and foreign antigens, inducing cell cycle exit in naive CD4+ T-cells before effector differentiation.
  • Antiviral response regulation: Negatively regulates RLR-mediated antiviral response by promoting SMURF1-mediated ubiquitination and degradation of MAVS.
  • Potassium channel regulation: Negatively regulates KCNH2 potassium channel activity by reducing cell-surface expression and interfering with channel maturation through NEDD4L recruitment to the Golgi apparatus, resulting in KCNH2 degradation.
  • Neuroprotection: In cortical neurons, it mediates NEDD4L-dependent ubiquitination and down-regulation of SLC11A2/DMT1, protecting against cobalt and iron toxicity.
  • Dendritic development: Important for normal dendritic and dendritic spine development in the cortex.
  • BRAT1 regulation: Enhances NEDD4, NEDD4L, and ITCH-mediated BRAT1 ubiquitination, facilitating nuclear localization of ubiquitinated BRAT1.
  • MAP3K7 regulation: Enhances ITCH-mediated ubiquitination of MAP3K7 by recruiting UBE2L3 to ITCH.
  • EGFR signaling modulation: Modulates EGFR signaling, potentially regulating the AKT1-to-MAPK8 signaling ratio in response to EGF, influencing cell growth rate via PTEN destabilization and ITCH-dependent MAP2K4 inactivation.
  • Cell proliferation inhibition: Inhibits cell proliferation by promoting PTEN nuclear localization and altering its signaling specificity.
Gene References Into Functions
  1. NDFIP1, a direct target of miR-155, was shown to influence uveal melanoma cell proliferation and invasion. (PMID: 29333944)
  2. NDFIP1 expression reduction correlated with decreased α-synuclein expression in an in vitro Parkinson's disease model. (PMID: 27173227)
  3. NDFIP1 silencing inhibited cytokine-induced apoptosis in pancreatic islets and promoted glucose-stimulated insulin secretion, linked to increased JunB content. (PMID: 26319551)
  4. NDFIP1 is crucial for stress-induced BRAT1 ubiquitination and nuclear trafficking. (PMID: 25631046)
  5. In Parkinson's disease, elevated iron levels are associated with increased NDFIP1 expression regulating DMT1, including abnormal activation in astrocytes. (PMID: 24475238)
  6. Cellular upregulation of NDFIP1 was observed with low levels of bioactive cobalt complexes. (PMID: 21187286)
  7. NDFIP1 is necessary for the exosomal secretion of Nedd4 family proteins. (PMID: 18819914)
  8. NDFIP1 plays a critical role in regulating metal transport in human neurons via DMT1 regulation. (PMID: 19706893)
Database Links

HGNC: 17592

OMIM: 612050

KEGG: hsa:80762

STRING: 9606.ENSP00000253814

UniGene: Hs.653510

Subcellular Location
Endosome membrane; Multi-pass membrane protein. Golgi apparatus membrane. Cell junction, synapse, synaptosome. Cell projection, dendrite. Secreted. Note=Detected in exosomes and secreted via the exosomal pathway (PubMed:18819914).
Tissue Specificity
Widely expressed. Higher levels are detected in cerebellum, pituitary, thalamus, kidney, liver, testis, salivary glands and placenta. Also expressed in fetal brain, kidney and lung.

Q&A

What is the basic function of NDFIP1 in cellular processes?

NDFIP1 serves as an adaptor protein that facilitates and activates HECT domain-containing E3 ubiquitin-protein ligases, including NEDD4 and ITCH. This activation enables the ubiquitination and subsequent regulation of various target proteins, controlling their degradation, trafficking, and functional modulation . NDFIP1 plays crucial roles in multiple cellular processes by mediating these protein-protein interactions, ultimately affecting diverse pathways from immune regulation to neuronal function. Its activity connects ubiquitination machinery with specific substrate proteins that would otherwise not interact with E3 ligases directly .

How does NDFIP1 interact with the ubiquitin-proteasome pathway?

NDFIP1 functions by recognizing specific target proteins and recruiting E3 ubiquitin ligases like NEDD4, NEDD4L, and ITCH to these substrates. This recruitment enables ubiquitination, which can result in proteasomal degradation of the target proteins. For example, NDFIP1 mediates the degradation of the divalent metal transporter DMT1 by recruiting NEDD4-2, preventing cellular iron overload . Similarly, it regulates the turnover of transcription factors like JunB by facilitating its interaction with the E3 ligase Itch . This mechanism represents a controlled and specific approach to protein regulation, as NDFIP1 can determine which proteins enter the degradation pathway based on cellular requirements and environmental conditions.

What structural motifs in NDFIP1 are critical for its function as an adaptor protein?

NDFIP1 contains specific PY motifs (PPxY sequences) that are essential for binding to the WW domains present in NEDD4 family ubiquitin ligases. These interactions are crucial for NDFIP1's adaptor function, enabling it to bridge target proteins with E3 ligases. While the search results don't specify the exact structural motifs, we know that NDFIP1 is a transmembrane protein localized to the Golgi and post-Golgi vesicles such as endosomes . This localization is important for its function in protein trafficking and degradation pathways. Researchers investigating NDFIP1 structure-function relationships should focus on these PY motifs and transmembrane domains when designing mutational studies or protein interaction experiments.

How does NDFIP1 regulate T-cell function and tolerance?

NDFIP1 plays a critical role in regulating T-cell tolerance to both self and foreign antigens. It forces naive CD4+ T-cells to exit the cell cycle before they can become effector T-cells, thereby preventing excessive proliferation and potential autoimmunity . By activating E3 ubiquitin ligases like ITCH, NDFIP1 controls the degradation of transcription factors such as JUNB, which is essential for preventing chronic T-helper cell-mediated inflammation . Additionally, NDFIP1 restricts pro-inflammatory cytokine production in Th17 T-cells by promoting the ITCH-mediated ubiquitination and degradation of RORC . These mechanisms collectively establish NDFIP1 as a crucial regulator of peripheral T-cell tolerance.

What experimental approaches can be used to study NDFIP1's role in immune cell function?

Researchers can employ several methodological approaches to investigate NDFIP1's role in immune cells:

  • Conditional knockout models: Generate mice lacking NDFIP1 specifically in T-cells (e.g., Ndfip1 CD4-CKO) by inserting loxP sites around critical exons and crossing with CD4-Cre transgenic animals . This approach allows for lineage-specific deletion while avoiding systemic effects.

  • siRNA knockdown: Use NDFIP1-specific siRNA to transiently reduce NDFIP1 expression in cell culture models . This technique is particularly useful for studying acute effects of NDFIP1 depletion.

  • Ubiquitination assays: Perform co-immunoprecipitation experiments with target proteins and ubiquitin to analyze how NDFIP1 manipulation affects ubiquitination patterns .

  • Flow cytometry and cell proliferation assays: Analyze T-cell activation, division, and differentiation markers to assess how NDFIP1 modulates immune cell proliferation and function.

What are the consequences of NDFIP1 deficiency for immune homeostasis?

NDFIP1 deficiency leads to significant disruptions in immune homeostasis. Mice lacking NDFIP1 specifically in T-cells develop inflammatory conditions characterized by excessive T-cell activation and proliferation . The loss of NDFIP1 prevents the proper regulation of transcription factors like JUNB, resulting in uncontrolled T-helper cell responses and chronic inflammation . Additionally, NDFIP1 deficiency impairs peripheral T-cell tolerance to both self and foreign antigens, as T-cells fail to exit the cell cycle appropriately and instead continue to proliferate and acquire effector functions . This dysregulation can contribute to autoimmune-like conditions and hypersensitivity to innocuous antigens. Understanding these consequences helps researchers identify potential therapeutic targets for inflammatory and autoimmune disorders.

How does NDFIP1 contribute to exosome secretion and function?

NDFIP1 plays a significant role in exosome biology by enhancing exosome secretion from cells. Studies have demonstrated that NDFIP1 is detectable within exosomes secreted from both transfected cells and primary neurons . Compared to control conditions, NDFIP1 expression increases exosome secretion, suggesting it functions as a positive regulator of this process . Furthermore, NDFIP1 facilitates the recruitment of Nedd4 family proteins (Nedd4, Nedd4-2, and Itch) into exosomes, despite these proteins normally being absent from these vesicles . This mechanism provides a novel pathway for protein trafficking and intercellular communication, potentially allowing for the transfer of ubiquitination machinery between cells through exosomal cargo loading.

What techniques can be used to study NDFIP1's role in exosome biogenesis and secretion?

Researchers investigating NDFIP1's role in exosome biology can employ several methodological approaches:

  • Exosome isolation and characterization: Use differential ultracentrifugation, size-exclusion chromatography, or commercial isolation kits to purify exosomes from cell culture supernatants or biological fluids. Then analyze exosome quantity and size distribution using nanoparticle tracking analysis, electron microscopy, or dynamic light scattering.

  • Proteomic analysis: Perform mass spectrometry on isolated exosomes from NDFIP1-expressing versus control cells to identify proteins specifically enriched in NDFIP1-associated exosomes.

  • Fluorescent labeling and live imaging: Generate fluorescently tagged NDFIP1 constructs to visualize its trafficking through the endosomal system and incorporation into multivesicular bodies and exosomes.

  • NDFIP1 overexpression/knockdown: Compare exosome secretion rates and composition between cells with modified NDFIP1 expression to establish causality between NDFIP1 levels and exosome characteristics .

How does NDFIP1 regulate intracellular protein trafficking beyond exosomes?

Beyond its role in exosome secretion, NDFIP1 regulates intracellular protein trafficking through its interactions with NEDD4 family ubiquitin ligases. NDFIP1 is localized to the Golgi and post-Golgi vesicles such as endosomes, positioning it strategically within protein transport pathways . One example of this trafficking function is NDFIP1's negative regulation of KCNH2 potassium channel activity by decreasing its cell-surface expression and interfering with channel maturation . This occurs through the recruitment of NEDD4L to the Golgi apparatus, where it mediates KCNH2 degradation . Similarly, in cortical neurons, NDFIP1 mediates the ubiquitination of the divalent metal transporter SLC11A2/DMT1 by NEDD4L, leading to its down-regulation and protecting cells from metal toxicity . These examples demonstrate NDFIP1's critical role in controlling protein localization, abundance, and function through targeted trafficking regulation.

How does NDFIP1 contribute to neuroprotection mechanisms?

NDFIP1 exhibits significant neuroprotective properties through several mechanisms. Research has demonstrated that metal ions, particularly cobalt and iron, can stimulate the expression of NDFIP1 in the brain, activating the ubiquitin proteasome pathway . This activation leads to the regulation of proteins like divalent metal transporter 1 (DMT1), preventing cellular iron overload that could otherwise cause neuronal damage . The neuroprotective role of NDFIP1 is further evidenced by studies showing that its up-regulation provides protection against cell death from oxidative stressors such as hydrogen peroxide . Additionally, NDFIP1 is important for normal development of dendrites and dendritic spines in the cortex, suggesting a role in neuronal structural integrity . Researchers have developed innovative approaches to harness NDFIP1's neuroprotective potential, including the design of metal complexes capable of delivering low, biologically effective levels of cobalt into cells to up-regulate NDFIP1 without causing metal toxicity .

What therapeutic strategies could target or utilize NDFIP1 function?

Several therapeutic strategies could be developed to target or leverage NDFIP1 function:

  • Metal complex delivery systems: As demonstrated in research, non-toxic metal complexes could be used for controlled intracellular delivery of cobalt to stimulate NDFIP1 expression, providing neuroprotection without metal toxicity . This approach represents a novel drug design strategy that can overcome traditional hurdles of metal toxicity while maintaining biological efficacy.

  • Immunomodulatory therapies: Given NDFIP1's role in T-cell tolerance and prevention of autoimmunity, enhancing its function could potentially benefit patients with autoimmune disorders or inflammatory conditions . Conversely, in cancer contexts where enhanced immune activation is desired, temporary inhibition of NDFIP1 might boost anti-tumor immune responses.

  • Exosome-based approaches: Since NDFIP1 increases exosome secretion and recruits ubiquitination machinery into exosomes, it could be utilized in exosome engineering for therapeutic protein delivery or removal of pathological proteins .

  • Cancer diagnostics and personalized therapy: NDFIP1 expression patterns could inform breast cancer prognosis and potentially predict immunotherapy response, enabling more personalized treatment approaches .

What are effective methods for producing recombinant human NDFIP1 protein?

To produce high-quality recombinant human NDFIP1 protein, researchers should consider the following approach:

  • Expression system selection: E. coli systems are suitable for producing protein fragments, while mammalian or insect cell systems may be preferred for full-length NDFIP1 with proper post-translational modifications.

  • Construct design: Based on available data, focusing on human NDFIP1 amino acids 1-150 has been successful for generating antibodies and functional studies . Include appropriate tags (His, GST, or FLAG) for purification and detection.

  • Solubility optimization: NDFIP1 is a transmembrane protein, so solubility can be challenging. Consider using detergents for extraction or generating soluble fragments without transmembrane domains.

  • Purification strategy: Implement a multi-step purification process including affinity chromatography (based on included tag), followed by size exclusion and/or ion exchange chromatography to achieve high purity.

  • Quality control: Verify protein identity and integrity using western blotting, mass spectrometry, and functional binding assays with known NDFIP1 interacting partners like NEDD4 or ITCH.

What genetic models are available for studying NDFIP1 function in vivo?

Several genetic models have been developed for studying NDFIP1 function in vivo:

  • Conditional knockout mice: Mice with loxP sites flanking critical exons of NDFIP1 (such as exon 2 or 3) have been generated . These can be crossed with tissue-specific Cre lines (e.g., CD4-Cre for T-cell-specific deletion) to study NDFIP1 function in specific cell types while avoiding potential embryonic lethality of global knockouts.

  • Floxed allele models: Researchers have generated floxed NDFIP1 mice where exon 3 is flanked by loxP sites . These models often include FRT-flanked selection cassettes that can be removed by crossing with Flpe-expressing mice.

  • Combined genetic approaches: Studies have investigated interactions between NDFIP1 and other pathways by generating compound mutant mice, such as crossing NDFIP1 conditional models with floxed Beclin 1 or PTEN mice .

The development of these models typically involves careful design of targeting constructs, ES cell manipulation, chimera generation, and extensive backcrossing to establish pure genetic backgrounds (e.g., C57BL/6) followed by genotype confirmation using PCR with specific primers .

What are the most reliable antibodies and detection methods for NDFIP1 in different experimental contexts?

For reliable detection of NDFIP1 across various experimental applications, researchers should consider:

  • Validated antibodies: Rabbit polyclonal antibodies raised against recombinant fragments of human NDFIP1 (amino acids 1-150) have been successfully used in multiple applications . For example, product ab236892 has been validated for Western blotting (WB), immunohistochemistry on paraffin-embedded tissues (IHC-P), and immunocytochemistry/immunofluorescence (ICC/IF) .

  • Application-specific considerations:

    • Western blotting: Ensure proper sample preparation, particularly for this transmembrane protein. Use appropriate detergents for extraction and verify band specificity with positive and negative controls.

    • Immunohistochemistry: Optimize antigen retrieval methods for formalin-fixed tissues. Both DAB and fluorescent detection systems have been successfully employed .

    • Cell-based assays: For flow cytometry or ICC/IF, validation with NDFIP1 knockout or knockdown cells is crucial to confirm specificity.

  • Expression analysis alternatives: When antibody-based detection is problematic, RT-qPCR for mRNA expression or tagged recombinant constructs can provide alternative detection approaches.

How does NDFIP1 interact with other signaling pathways beyond ubiquitination?

NDFIP1 intersects with multiple signaling networks beyond its direct role in ubiquitination, functioning as a central hub in cellular regulation:

  • Immune signaling pathways: NDFIP1 limits cytokine signaling in effector Th2 T-cells by promoting degradation of JAK1, likely through ITCH- and NEDD4L-mediated ubiquitination . This directly impacts JAK-STAT signaling, a central pathway in immune function.

  • Antiviral response regulation: NDFIP1 negatively regulates RLR-mediated antiviral responses by promoting SMURF1-mediated ubiquitination and subsequent degradation of MAVS . This influences innate immune signaling cascades that recognize viral nucleic acids.

  • Unfolded protein response (UPR): In pancreatic beta cells, NDFIP1 affects insulin secretion through promoting JUNB degradation and inhibiting the unfolded protein response . This links NDFIP1 to ER stress pathways and cellular metabolism.

  • Memory formation pathways: NDFIP1 has been identified as a novel negative regulator for spatial memory formation, suggesting involvement in neuronal plasticity and memory-related signaling .

These diverse interactions position NDFIP1 as a multifunctional regulator that coordinates cellular responses across immune, metabolic, and neurological systems.

What is the relationship between NDFIP1 and immune checkpoint molecules?

Research has revealed important relationships between NDFIP1 and immune checkpoint molecules:

  • Negative correlation with checkpoint expression: Analysis of TCGA database data indicates a negative correlation between NDFIP1 and immune checkpoint molecules, including PDCD1/PD1 and CTLA4 . This inverse relationship suggests potential regulatory interactions between these pathways.

  • Impact on immunotherapy response: The NDFIP1 low expression group demonstrated superior immunotherapy effects across four immunotherapy groups (CTLA4-PD1-, CTLA4-PD1+, CTLA4+PD1-, CTLA4+PD1+) . This finding has significant implications for predicting immunotherapy efficacy.

  • Validation through IHC analysis: Immunohistochemistry scores have verified correlations between NDFIP1 and multiple immune checkpoints (CD276, IDO1, PD1, and LAIR1), confirming the relationship observed in genomic databases .

These findings suggest that NDFIP1 may function as a regulatory node in immune checkpoint biology, potentially influencing T-cell activation thresholds and anti-tumor immune responses. The precise molecular mechanisms underlying these correlations remain to be fully elucidated, representing an important area for future research.

How is NDFIP1 expression regulated in different cellular contexts?

NDFIP1 expression is subject to complex regulation that varies across cellular contexts:

  • Metal ion-induced regulation: Cobalt and iron ions can stimulate NDFIP1 expression in neuronal cells, representing a stress-response mechanism . This regulation appears to involve a distinct cellular pathway, as researchers have developed metal complexes capable of delivering low, biologically effective levels of cobalt to upregulate NDFIP1 with sustainable biological effects .

  • Tissue-specific expression patterns: NDFIP1 shows differential expression between normal and pathological tissues. In breast cancer, for instance, NDFIP1 protein levels in normal breast tissues were higher than in tumor tissues as demonstrated by immunohistochemical staining .

  • Correlation with demographic and clinical factors: In breast cancer patients, NDFIP1 expression correlates with age, tumor stage, and race, suggesting complex regulatory influences from both intrinsic cellular programs and broader physiological factors .

  • TCR signaling and T-cell activation: While not explicitly stated in the search results, NDFIP1's role in T-cell regulation suggests its expression may be modulated during T-cell activation, potentially as part of regulatory feedback mechanisms that prevent excessive immune responses .

Understanding these diverse regulatory mechanisms provides insights into how NDFIP1 function is tailored to specific cellular needs and environmental conditions.

How can NDFIP1 be targeted for studying protein-protein interactions in living cells?

Researchers can employ several sophisticated approaches to study NDFIP1-mediated protein-protein interactions in living cells:

  • Proximity labeling techniques: BioID or TurboID fusion constructs with NDFIP1 can identify proximal interacting proteins in living cells through biotinylation of nearby proteins, followed by streptavidin pulldown and mass spectrometry analysis.

  • FRET/BRET analysis: Fluorescence or bioluminescence resonance energy transfer pairs (NDFIP1 fused to donor fluorophore and potential interaction partners with acceptor fluorophores) can detect direct protein interactions in real-time within living cells.

  • Split-protein complementation assays: Techniques like BiFC (Bimolecular Fluorescence Complementation) where NDFIP1 and potential partners are fused to complementary fragments of a fluorescent protein. Interaction brings the fragments together, restoring fluorescence.

  • Optogenetic approaches: Light-inducible dimerization systems can be used to temporally control NDFIP1 interactions with E3 ligases or substrates, allowing precise manipulation of ubiquitination events in specific cellular compartments.

These methodologies offer distinct advantages for studying the dynamic nature of NDFIP1's adapter function in coordinating protein degradation and trafficking within intact cellular environments.

What are the challenges in developing NDFIP1-targeted therapeutics?

Developing therapeutics targeting NDFIP1 faces several significant challenges:

  • Context-dependent function: NDFIP1 plays diverse roles across different cell types and physiological states. In T-cells, it limits inflammation and prevents autoimmunity , while in cancer contexts, its high expression may correlate with poorer outcomes . This dual nature makes broad targeting problematic.

  • Protein-protein interaction targeting: As an adaptor protein, NDFIP1's function relies on multiple protein-protein interactions rather than enzymatic activity, making it challenging to disrupt with small molecules. Developing effective protein-protein interaction inhibitors remains a pharmaceutical challenge.

  • Intracellular localization: NDFIP1 functions primarily within intracellular compartments like the Golgi and endosomes , requiring therapeutic agents that can effectively penetrate cell membranes and reach these specific locations.

  • Delivery systems complexity: The most promising approaches may involve sophisticated delivery systems, such as metal complexes for controlled release of NDFIP1-inducing agents . These complex formulations face additional regulatory and manufacturing hurdles.

  • Target validation complexity: While animal models with NDFIP1 deletion exist , translating findings from these models to human therapeutics requires careful validation of potentially different mechanisms and pathway interactions across species.

How might single-cell analysis techniques advance our understanding of NDFIP1 function?

Single-cell analysis techniques offer powerful approaches to elucidate NDFIP1 function across heterogeneous cell populations:

  • Single-cell RNA sequencing (scRNA-seq): This technique could reveal how NDFIP1 expression varies across immune cell subsets and stages of activation. By comparing transcriptomes of NDFIP1-high versus NDFIP1-low cells within the same tissue, researchers could identify cell-specific downstream effects and regulatory networks.

  • Single-cell proteomics: Mass cytometry (CyTOF) or similar approaches combining NDFIP1 detection with markers of cell state, signaling pathway activation, and ubiquitination could map how NDFIP1 levels correlate with protein degradation patterns at the single-cell level.

  • Spatial transcriptomics: These methods could reveal how NDFIP1 expression varies across tissue microenvironments, potentially identifying niches where its function is particularly important, such as in tumor-immune interfaces or neuronal synapses.

  • Lineage tracing with NDFIP1 reporters: Combining genetic NDFIP1 reporters with single-cell sequencing could track cell fate decisions influenced by NDFIP1 activity, particularly relevant for understanding its role in T-cell tolerance development .

These approaches would help resolve conflicting observations about NDFIP1 function by revealing how its effects vary across different cellular contexts, activation states, and tissue environments.

What are the emerging areas of investigation for NDFIP1 beyond current applications?

Several promising research directions are emerging for NDFIP1 investigation:

  • Role in neurological disorders: Given NDFIP1's importance for normal dendrite development and neuroprotective properties , its potential involvement in neurodegenerative diseases and stroke recovery represents an important area for investigation.

  • Metabolism and metabolic diseases: NDFIP1's role in pancreatic beta cell function and insulin secretion suggests potential implications for diabetes and metabolic syndrome that warrant deeper exploration.

  • Exosome-mediated intercellular communication: As NDFIP1 influences exosome secretion and cargo loading , studying how NDFIP1-mediated exosomal transfer affects recipient cell function could reveal novel intercellular signaling mechanisms.

  • Developmental biology: The role of NDFIP1 in spatial memory formation hints at broader functions in neuronal development and plasticity that could extend to other developmental processes.

  • Systems biology approaches: Integrating NDFIP1 function into broader ubiquitination networks and cellular decision-making processes using computational modeling could reveal emergent properties and system-level effects.

These emerging areas promise to expand our understanding of NDFIP1 beyond its established roles in immune regulation and protein trafficking.

How might transcriptomic and proteomic approaches advance NDFIP1 research?

Integrative transcriptomic and proteomic approaches offer powerful tools to advance NDFIP1 research:

  • Global ubiquitinome analysis: Using ubiquitin remnant profiling (K-ε-GG) mass spectrometry in control versus NDFIP1-deficient cells could comprehensively identify proteins whose ubiquitination status depends on NDFIP1, expanding our understanding beyond the few known substrates.

  • Temporal dynamics studies: Time-resolved proteomics following NDFIP1 induction or deletion could reveal the sequence of events in ubiquitination cascades, identifying primary versus secondary effects of NDFIP1 activity.

  • Multi-omics integration: Combining transcriptomics, proteomics, and ubiquitinome analysis with phosphoproteomics could map how NDFIP1-mediated ubiquitination interfaces with other post-translational modification networks to coordinate cellular responses.

  • Subcellular proteomics: Organelle-specific proteomic analysis could determine how NDFIP1 affects protein composition of endosomes, Golgi, and other compartments where it functions, providing spatial context to its activity.

  • Interactome mapping: Comprehensive identification of the NDFIP1 interactome under different cellular conditions could reveal context-specific binding partners and regulatory mechanisms.

These approaches would help resolve the complex, context-dependent functions of NDFIP1 by providing system-level views of its impacts on cellular proteomes and transcriptomes.

What technological innovations might enhance the study of NDFIP1's role in real-time cellular processes?

Several technological innovations could significantly advance real-time studies of NDFIP1 function:

  • Live-cell ubiquitination sensors: Development of fluorescent biosensors that report on ubiquitination of specific NDFIP1 targets could enable visualization of these processes in living cells with temporal and spatial resolution.

  • Optogenetic control of NDFIP1 activity: Light-inducible systems that allow precise spatiotemporal activation or inhibition of NDFIP1 function would enable causal studies of its roles in specific cellular compartments and time windows.

  • CRISPR-based endogenous tagging: CRISPR knock-in approaches to tag endogenous NDFIP1 with fluorescent proteins or degrons would allow visualization or controlled degradation of the protein without overexpression artifacts.

  • Intravital microscopy with NDFIP1 reporters: Combining NDFIP1 activity reporters with intravital imaging could reveal its function in intact tissues during immune responses, neuronal activity, or disease progression.

  • Microfluidic single-cell analysis: Systems that capture individual cells for real-time monitoring of NDFIP1 activity followed by molecular analysis could connect real-time observations with molecular mechanisms.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.