Recombinant Human NEDD4 family-interacting protein 2 (NDFIP2)

Shipped with Ice Packs
In Stock

Description

General Information

Recombinant Human NEDD4 family-interacting protein 2 (NDFIP2) is a protein encoded by the NDFIP2 gene in humans . It is involved in controlling inflammatory signaling pathways and acts as an essential component of a ubiquitin-editing protein complex, which includes TNFAIP3, TAX1BP1, and others . NDFIP2 activates HECT domain-containing E3 ubiquitin-protein ligases such as ITCH, NEDD4, NEDD4L, SMURF2, WWP1, and WWP2, influencing the stability of their targets and thereby controlling many cellular processes .

Table 1: General Information of NDFIP2

FeatureDescription
Gene NameNDFIP2
SynonymsN4WBP5A
Protein NameNEDD4 family-interacting protein 2
NCBI Gene ID54602
Molecular FunctionSignal transducer activity, protein binding, WW domain binding
Cellular ComponentCytoplasm, integral component of membrane, endosome
InteractionsInteracts with NEDD4
Size336 amino acids
Functional AssociationsHas 3,773 functional associations with biological entities spanning 8 categories, including molecular profile, organism, functional term, and disease

Function and Mechanism

NDFIP2 modulates the stability of target proteins by activating HECT domain-containing E3 ubiquitin-protein ligases . It recruits ITCH, NEDD4, and SMURF2 to endosomal membranes . NDFIP2 negatively regulates KCNH2 potassium channel activity by reducing its cell-surface expression and interfering with channel maturation through the recruitment of NEDD4L to the Golgi apparatus and multivesicular body, where it mediates KCNH2 degradation . NDFIP1 and NDFIP2 bind to NEDD4 family members via PY motifs, bringing them close to target proteins .

Role in Ubiquitination and Degradation

NDFIP proteins are essential for NEDD4/NEDD4L-mediated ubiquitination and degradation of proteins such as AQP2 . NDFIP1 and NDFIP2 link NEDD4 or NEDD4L to AQP2, leading to AQP2 degradation . NDFIP1 also promotes the degradation of the divalent metal transporter (DMT1) membrane protein .

Interaction with NEDD4 Family Ligases

NDFIP2 interacts with several NEDD4 family E3 ubiquitin ligases, including NEDD4, WWP1, and WWP2 . These ligases accept ubiquitin from an E2 ubiquitin-conjugating enzyme and transfer it to target substrates . For example, NEDD4 ubiquitinates IGF1R, leading to receptor internalization and degradation in lysosomes . WWP2 polyubiquitinates POU5F1, promoting its proteasomal degradation . WWP1 ubiquitinates ERBB4 isoforms, KLF2, KLF5, and TP63, promoting their proteasomal degradation .

Table 2: Predicted Functional Partners of NDFIP2

ProteinDescriptionConfidence Score
NEDD4E3 ubiquitin-protein ligase involved in the degradation of VEGFR-2/KDFR, and ubiquitinates IGF1R and FGFR1, leading to receptor internalization and degradation in lysosomes 0.998
WWP2E3 ubiquitin-protein ligase that polyubiquitinates POU5F1, promoting its proteasomal degradation, and ubiquitinates EGR2, inhibiting activation-induced cell death 0.857
WWP1E3 ubiquitin-protein ligase that ubiquitinates ERBB4 isoforms, KLF2, KLF5, and TP63, promoting their proteasomal degradation, and ubiquitinates TGFBR1, enhancing its degradation by SMAD7 0.718
SLC11A2Important in metal transport, particularly iron, and involved in apical iron uptake into duodenal enterocytes and iron transport from acidified endosomes into the cytoplasm of erythroid precursor cells 0.693
PTENTumor suppressor that acts as a dual-specificity protein and lipid phosphatase, dephosphorylating tyrosine-, serine- and threonine- phosphorylated proteins, and removing phosphate from phosphatidylinositol phosphates 0.659
NDFIP1Activates HECT domain-containing E3 ubiquitin-protein ligases, including NEDD4 and ITCH, modulating the stability of their targets, preventing chronic T-helper cell-mediated inflammation, promoting pancreatic beta cell death, and restricting the production of proinflammatory cytokines in effector Th17 T-cells 0.658

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional fees.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for your reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing. If you require a specific tag, please inform us; we will prioritize its development.
The tag type will be determined during the production process. Please specify your tag requirements for preferential development.
Synonyms
NDFIP2; KIAA1165; N4WBP5A; NEDD4 family-interacting protein 2; NEDD4 WW domain-binding protein 5A; Putative MAPK-activating protein PM04/PM05/PM06/PM07; Putative NF-kappa-B-activating protein 413
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-336
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
Target Protein Sequence
MARRRSQRVCASGPSMLNSARGAPELLRGTATNAEVSAAAAGATGSEELPPGDRGCRNGG GRGPAATTSSTGVAVGAEHGEDSLSRKPDPEPGRMDHHQPGTGRYQVLLNEEDNSESSAI EQPPTSNPAPQIVQAASSAPALETDSSPPPYSSITVEVPTTSDTEVYGEFYPVPPPYSVA TSLPTYDEAEKAKAAAMAAAAAETSQRIQEEECPPRDDFSDADQLRVGNDGIFMLAFFMA FIFNWLGFCLSFCITNTIAGRYGAICGFGLSLIKWILIVRFSDYFTGYFNGQYWLWWIFL VLGLLLFFRGFVNYLKVRNMSESMAAAHRTRYFFLL
Uniprot No.

Target Background

Function

Recombinant Human NEDD4 family-interacting protein 2 (NDFIP2) activates HECT domain-containing E3 ubiquitin-protein ligases, including ITCH, NEDD4, NEDD4L, SMURF2, WWP1, and WWP2. This activation modulates the stability of their target proteins, influencing numerous cellular processes. NDFIP2 recruits ITCH, NEDD4, and SMURF2 to endosomal membranes. It negatively regulates KCNH2 potassium channel activity by reducing cell-surface expression and interfering with channel maturation. This interference involves recruitment of NEDD4L to the Golgi apparatus and multivesicular body, mediating KCNH2 degradation. NDFIP2 may also modulate EGFR signaling and, in conjunction with NDFIP1, limits cytokine signaling and effector Th2 T-cell expansion by promoting JAK1 degradation, likely through ITCH- and NEDD4L-mediated ubiquitination.

Gene References Into Functions
  1. NDFIP1 recruits the E3 ubiquitin ligase NEDD4-2 to the Golgi apparatus, targeting the hERG channel for degradation. NDFIP2 also mediates NEDD4-2 interaction with hERG in the Golgi. PMID: 26363003
  2. NDFIP1 and NDFIP2 regulate PTEN/Akt and MAP kinase signaling pathways by activating ubiquitin ligases. PMID: 20534535
  3. NDFIP2 plays a role in regulating epithelial sodium channels. PMID: 12050153
  4. N4WBP5A (NDFIP2) may regulate NEDD4 activity within the Golgi apparatus of T lymphocytes. PMID: 12796489
  5. N4WBP5A acts as an adaptor, recruiting NEDD4 family ubiquitin-protein ligases to the protein trafficking machinery. PMID: 15252135
  6. NDFIP1 and NDFIP2 activate the catalytic activity of ITCH and other HECT ligases through binding interactions. PMID: 19343052
Database Links

HGNC: 18537

OMIM: 610041

KEGG: hsa:54602

STRING: 9606.ENSP00000218652

UniGene: Hs.525093

Subcellular Location
Endosome membrane; Multi-pass membrane protein. Golgi apparatus membrane. Endosome, multivesicular body membrane.
Tissue Specificity
Expressed in brain, lung, heart, skeletal muscle, kidney, liver and placenta.

Q&A

What is NDFIP2 and what are its basic molecular characteristics?

NDFIP2 (also known as N4WBP5A) is a protein-coding gene that functions as an adaptor protein for the NEDD4 family of E3 ubiquitin ligases. Located on chromosome 13 at position 13q31.1, NDFIP2 spans from base pair 79,481,155 to 79,556,077 on the reference sequence NC_000013.11 and contains 8 exons . NDFIP2 enables WW domain binding activity and is primarily involved in the negative regulation of transport and regulation of macromolecule metabolic processes .

The protein is membrane-anchored and serves as a critical recruitment factor that mediates the localization and activity of NEDD4 family ubiquitin ligases at specific subcellular compartments. This recruitment function allows NDFIP2 to regulate target protein ubiquitination and subsequent degradation in a spatially controlled manner .

Where is NDFIP2 localized in cells?

NDFIP2 displays a complex subcellular distribution pattern that directly relates to its diverse functions. According to recent research, NDFIP2 is located in several cellular components, including:

  • Golgi apparatus

  • Mitochondria

  • Perinuclear region of cytoplasm

  • Lysosomal vesicles

This differential localization is significant because it allows NDFIP2 to recruit NEDD4 family E3 ligases to specific membrane compartments, thereby regulating protein ubiquitination in a spatially controlled manner. For instance, studies have shown that NDFIP2 mediates the distribution of both IFITM3 and NEDD4 in lysosomal vesicles, suggesting its role in directing protein degradation pathways .

What protein domains and binding motifs are present in NDFIP2?

NDFIP2 contains several critical functional domains and motifs that mediate its interactions with NEDD4 family proteins:

  • PY motifs: NDFIP2 contains consensus PY ((L/P)PXY) binding sites that are essential for interactions with WW domains of HECT-type E3 ubiquitin ligases .

  • Transmembrane domains: These anchor NDFIP2 to various cellular membranes, allowing it to serve as a recruitment platform for otherwise cytoplasmic HECT E3 ligases .

  • WW domain binding sites: These regions facilitate specific protein-protein interactions with NEDD4 family members and their substrates .

The presence of these domains explains how NDFIP2 can function as an adaptor that recruits both E3 ligases and their substrates to specific cellular locations, thereby facilitating ubiquitination reactions in a controlled manner.

How does NDFIP2 interact with NEDD4 family proteins?

NDFIP2 functions as a membrane-anchored adaptor protein that recruits NEDD4 family ubiquitin ligases to specific subcellular locations. The interaction between NDFIP2 and NEDD4 family proteins occurs primarily through PY motifs on NDFIP2 that bind to WW domains on the NEDD4 family members .

This interaction is functionally significant because:

  • It recruits otherwise cytoplasmic HECT E3 ligases to membrane compartments

  • It can either stimulate or suppress E3 ligase activity in a context-dependent manner

  • It creates localized hubs of ubiquitination activity that regulate specific substrate proteins

Experimental evidence using GST pull-down approaches has demonstrated that the C-terminal domain of TTYH2 (a chloride channel protein) interacts with HECT domain-containing proteins, including NEDD4 or NEDD4-2, through similar PY-WW domain interactions .

How does NDFIP2 regulate ubiquitination of target proteins?

NDFIP2 employs a complex regulatory mechanism that can both enhance and suppress ubiquitination of target proteins in different contexts. Recent studies have revealed that:

These findings suggest that NDFIP2 acts as a contextual regulator that can fine-tune the ubiquitination activity of NEDD4 family ligases depending on cellular conditions and subcellular localization.

What experimental approaches can differentiate between direct and indirect NDFIP2 interactions?

To distinguish between direct and indirect interactions of NDFIP2 with NEDD4 family proteins and substrates, researchers can employ the following methodologies:

  • Pull-down assays with purified recombinant proteins: GST-fusion proteins containing specific domains of NDFIP2 can be used to pull down potential interaction partners from cell lysates, as demonstrated in studies of TTYH2 interactions .

  • Isothermal Titration Calorimetry (ITC): This technique provides direct measurement of binding affinities between purified proteins. It has been successfully used to characterize interactions between peptides and HECT domains with Kd values in the micromolar range .

  • Hydrogen-Deuterium Exchange Mass Spectrometry: This method can identify interaction interfaces between NDFIP2 and its binding partners by measuring changes in hydrogen-deuterium exchange rates upon complex formation .

  • Fluorescence Polarization Assays: These assays can monitor real-time binding between fluorescently labeled NDFIP2 peptides and purified NEDD4 family proteins, providing both kinetic and equilibrium binding data .

  • Co-immunoprecipitation of endogenous proteins: This approach can validate physiologically relevant interactions under normal cellular conditions without protein overexpression artifacts .

What is the role of NDFIP2 in antiviral immune responses?

NDFIP2 plays a critical role in regulating antiviral immunity through its interactions with Interferon-Induced Transmembrane (IFITM) proteins, particularly IFITM3. Recent proteomics-based research has revealed several key aspects of this relationship:

  • NDFIP2 acts as a positive regulator of IFITM3, a protein with broad antiviral properties that interferes with fusion between viral and cellular membranes .

  • NDFIP2 recruits both IFITM3 and NEDD4 to lysosomal vesicles, where it appears to locally compete with IFITM3 for NEDD4 binding .

  • Genetic inactivation of NDFIP2 using CRISPR/Cas9 results in lower cellular levels of IFITM3, making cells more susceptible to viral infection .

  • Conversely, overexpression of NDFIP2 leads to higher levels of IFITM3 accumulation, potentially enhancing cellular antiviral responses .

This regulatory relationship between NDFIP2 and IFITM3 represents a novel layer of control in antiviral immunity that responds dynamically to external stimuli. The fact that NDFIP2 is itself tightly regulated and responsive to external cues suggests it may function as a contextual modulator of antiviral responses under different physiological conditions .

How is NDFIP2 involved in ion channel regulation?

NDFIP2 plays a significant role in regulating the Tweety family of chloride ion channels through its interaction with NEDD4 family ubiquitin ligases. Experimental evidence has revealed:

  • NDFIP2 (via NEDD4-2) differentially interacts with members of the Tweety family of chloride ion channels - binding to TTYH2 and TTYH3, which contain consensus PY binding sites, but not to TTYH1, which lacks this motif .

  • The C-terminal domain of TTYH2 (residues 409-534) contains potential WW domain binding sites at positions 444SP, 504SP, 506PPTY, and 510SP that facilitate interaction with NEDD4-2 .

  • Endogenous TTYH2 and NEDD4-2 form binding partnerships mediated by the TTYH2 PY motif, which is essential for these interactions .

  • NEDD4-2-mediated ubiquitination of TTYH2 critically regulates both cell surface and total cellular levels of this chloride channel protein .

This regulatory mechanism has important implications for understanding how chloride channel activity is controlled in both normal physiology and disease states. Since proper spatial and temporal protein localization is essential for normal cellular function, these findings provide insight into how NDFIP2 may contribute to ion channel dysregulation in pathological conditions.

What disease associations have been identified for NDFIP2?

Research has linked NDFIP2 to several significant disease conditions, primarily through genome-wide association studies and functional analyses:

Disease/ConditionAssociation TypeStudy TypeReference
Major Depressive DisorderPharmacogenetic association with antidepressant efficacyGenome-wide meta-analysis
Pancreatic CancerGenetic association in Japanese populationGenome-wide association study
Viral SusceptibilityFunctional role in antiviral immunity via IFITM3 regulationCRISPR/Cas9 knockout studies

The association with antidepressant efficacy suggests NDFIP2 may play a role in the neurobiological mechanisms underlying treatment response in depression, though the precise molecular pathways remain to be fully elucidated .

The connection to pancreatic cancer in the Japanese population indicates potential ethnic-specific genetic risk factors involving NDFIP2, warranting further investigation into its role in oncogenic processes .

Most concretely, functional studies have demonstrated that NDFIP2 knockout cells exhibit increased susceptibility to viral infection due to lower IFITM3 levels, establishing a clear mechanistic link between NDFIP2 and antiviral immunity .

What are the optimal expression systems for producing recombinant human NDFIP2?

The production of functional recombinant human NDFIP2 presents several challenges due to its membrane-associated nature and complex post-translational modifications. Based on current research methodologies, the following expression systems offer distinct advantages:

  • Mammalian Cell Expression Systems:

    • Human cell lines (HEK293, HeLa) provide proper post-translational modifications and cellular machinery for correct folding and trafficking of NDFIP2

    • Appropriate for co-expression studies with NEDD4 family members and substrate proteins

    • Can be used with inducible promoters to control expression levels

  • Insect Cell Systems:

    • Baculovirus-infected Sf9 or High Five cells can produce higher yields while maintaining most post-translational modifications

    • Suitable for structural studies requiring larger protein quantities

    • Used successfully for related HECT-domain containing proteins

  • E. coli Systems with Fusion Tags:

    • GST fusion systems have been successfully used for expressing domains of NDFIP2 for pull-down experiments

    • Limited to soluble domains or peptide fragments containing specific binding motifs

    • Not ideal for full-length protein due to membrane association and post-translational modifications

The choice of expression system should be guided by the specific experimental requirements, with mammalian systems generally preferred for functional studies of full-length NDFIP2.

What experimental approaches can assess NDFIP2-mediated protein ubiquitination?

Several complementary methodologies can be employed to study NDFIP2's role in protein ubiquitination:

  • In Vitro Ubiquitination Assays:

    • Reconstituted systems using purified components (E1, E2, NEDD4 family E3, NDFIP2, and substrate)

    • Allows precise control of reaction components and conditions

    • Can be analyzed by Western blotting or ELISA-based detection methods

  • Cell-Based Ubiquitination Assays:

    • Transfection of tagged ubiquitin, NDFIP2, NEDD4 family members, and substrate proteins

    • Immunoprecipitation under denaturing conditions followed by detection of ubiquitinated species

    • Can be combined with NDFIP2 knockdown/knockout or overexpression

  • Alpha Screen Technology:

    • A bead-based proximity assay that can detect protein-protein interactions and post-translational modifications

    • Has been used successfully to screen for inhibitors of HECT-type ubiquitin ligases

    • Can be adapted to study NDFIP2-mediated effects on ubiquitination

  • Proteomics-Based Approaches:

    • Mass spectrometry analysis of the ubiquitinome in cells with modified NDFIP2 expression

    • Can identify novel substrates affected by NDFIP2 activity

    • Has been used successfully to identify NDFIP2 as a regulator of IFITM3

For quantitative assessment, researchers often employ ELISA-based detection methods that have been shown to provide reliable measurements of ubiquitination activity with IC50 values in the micromolar range for related inhibitors of HECT domains .

How can CRISPR/Cas9 gene editing be optimized for NDFIP2 functional studies?

CRISPR/Cas9 gene editing has emerged as a powerful tool for investigating NDFIP2 function through targeted knockout studies. Based on recent research approaches, the following considerations are important for optimizing CRISPR/Cas9 editing of NDFIP2:

  • Guide RNA Design:

    • Target early exons (particularly within the 8 exons of NDFIP2) to ensure complete functional knockout

    • Design multiple guide RNAs to increase editing efficiency and confirm phenotypes with independent guides

    • Validate guide RNA specificity using computational tools to minimize off-target effects

  • Cell Line Selection:

    • A549 cells have been successfully used for NDFIP2 knockout studies in the context of antiviral research

    • Choose cell lines that express detectable levels of endogenous NDFIP2 and its interacting partners

    • Consider cell types relevant to the physiological context being studied (immune cells, neurons, etc.)

  • Validation Strategies:

    • Confirm genomic editing by sequencing the target locus

    • Verify protein depletion by Western blot using NDFIP2-specific antibodies

    • Assess functional consequences by measuring levels of known NDFIP2-regulated proteins (e.g., IFITM3)

  • Phenotypic Analysis:

    • Compare NDFIP2 knockout cells with wild-type controls for susceptibility to viral infection

    • Examine ubiquitination status of known NDFIP2-regulated substrates

    • Analyze subcellular distribution of NEDD4 family members in the absence of NDFIP2

Researchers have successfully applied CRISPR/Cas9 technology to generate NDFIP2 knockout A549 cells, which exhibited lower levels of IFITM3 and increased susceptibility to viral infection, demonstrating the utility of this approach for functional studies .

What are the most effective small molecule inhibitors targeting NDFIP2-NEDD4 interactions?

Research on small molecule inhibitors specifically targeting NDFIP2-NEDD4 interactions is still emerging, but related work on HECT-type ubiquitin ligases provides valuable insights:

  • Bicycle Peptides:

    • Phage display libraries have been used to identify bicyclic peptides that bind to HECT domains of NEDD4 family members

    • The best bicycle inhibitor of Smurf2 (Smurf2-RYR) showed an IC50 of 2 μM and Kd of 2.5 μM

    • For Nedd4, the bicycle inhibitor Nedd4-RGS demonstrated an IC50 of approximately 8 μM

  • Small Molecule Inhibitor "Heclin":

    • Affects Ndfip2 ubiquitination, suggesting it disrupts the functional interaction between NDFIP2 and NEDD4 family members

    • Appears to work through a competitive inhibition mechanism with respect to E2 binding

  • Alpha Screen Technology Application:

    • This methodology has been successfully used to screen for small molecule inhibitors of HECT-type ubiquitin ligases

    • Could be adapted specifically for compounds that disrupt NDFIP2-NEDD4 interactions

When designing inhibition studies, researchers should consider that the IC50 values of inhibitors increase with higher concentrations of E2 enzyme, consistent with their role as competitive inhibitors of E2 binding . This suggests that optimal inhibitor concentrations may need to be determined empirically based on the specific experimental conditions.

How does NDFIP2 function differ from other NEDD4 family adaptors like NDFIP1?

While the search results don't directly compare NDFIP1 and NDFIP2, we can infer important functional differences based on the available information:

  • Subcellular Localization:

    • NDFIP2 shows distinct localization patterns, being present in the Golgi apparatus, mitochondria, perinuclear region, and lysosomal vesicles

    • This specific distribution pattern likely contributes to unique functional roles compared to other adaptor proteins

  • Substrate Specificity:

    • NDFIP2 has been specifically implicated in the regulation of IFITM3 levels and antiviral immunity

    • It also plays a role in regulating Tweety family chloride ion channels, particularly TTYH2 and TTYH3

    • These specific substrate interactions may distinguish NDFIP2 from other NEDD4 family adaptors

  • Regulatory Dynamics:

    • NDFIP2 appears to be "highly responsive to external cues," suggesting it may function as a more dynamic regulator compared to other adaptors

    • It can both positively and negatively influence substrate levels, as demonstrated by its complex effect on IFITM3 accumulation

Future comparative studies directly examining the functional differences between NDFIP1 and NDFIP2 would be valuable for understanding the specific roles of these adaptor proteins in different cellular contexts and disease states.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.