Recombinant Human Neuromedin-B receptor (NMBR)

Shipped with Ice Packs
In Stock

Description

Production and Expression Systems

Recombinant NMBR is produced via heterologous expression in mammalian cell lines (e.g., HEK293, CHO) for high-fidelity post-translational modifications. Commercial preparations include:

  • Membrane-bound forms: Used in radioligand binding assays (e.g., ChemiScreen™ Human BB1 Receptor Membrane Preparations) .

  • Cell lines: Engineered to overexpress NMBR for signaling pathway studies .

Functional Roles in Physiology and Disease

NMBR activation triggers diverse downstream pathways depending on cellular context:

Pain Signaling

  • Mechanism: NMBR activation in trigeminal ganglion neurons enhances Cav3.2 T-type Ca²⁺ channel currents via Gβγ-dependent AMPK/PKA pathways, leading to neuronal hyperexcitability and pain hypersensitivity .

  • Experimental Evidence:

    • Nmb (100 nM) increased T-type currents by 40–60% in small sensory neurons .

    • Cav3.2 knockdown or NMBR antagonism (BIM23042) attenuated mechanical pain in murine models .

Immune Regulation

  • Antiviral Response: NMBR upregulation during H1N1 influenza infection enhances IFN-α production and reduces viral replication in lung epithelial cells .

  • Key Data:

    • NMBR⁻/⁻ A549 cells showed 3.5-fold higher viral titers than controls .

    • NMB-treated mice exhibited 60% higher survival rates post-infection .

Cancer and Cell Proliferation

  • NMBR is overexpressed in lung, ovarian, and gastrointestinal tumors, promoting angiogenesis via ERK/Akt pathways .

  • Antagonists like PD 176252 inhibit tumor growth in preclinical models .

Research Applications of Recombinant NMBR

Recombinant NMBR is pivotal in:

ApplicationExperimental UseKey Findings
Drug DiscoveryHigh-throughput screening for NMBR antagonists PD 176252 blocks NMBR with IC₅₀ = 0.5 µM
Signal Transduction StudiesG protein coupling assays (Gαq/11, Gβγ) GDP-β-S (1 mM) abolished NMB-induced Ca²⁺ currents
Pathological ModelsInflammatory pain and viral infection models NMBR knockout mice show blunted pain responses

Pharmacological Tools Targeting NMBR

  • Antagonists:

    • PD 176252: Dual GRP-R/NMBR inhibitor (Kᵢ = 1 nM for NMBR) .

    • BIM23042: Selective NMBR antagonist used in neuronal studies .

  • siRNA/shRNA: Validated sequences for NMBR knockdown (e.g., MISSION esiRNA ).

Future Directions

Current research focuses on:

  • Therapeutic Targeting: Developing NMBR-specific antagonists for cancer and chronic pain.

  • Structural Biology: Cryo-EM studies to resolve NMBR’s active-state conformation for drug design.

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, kindly specify them when placing your order, and we will accommodate your request.
Lead Time
Delivery times may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery information.
Note: All of our proteins are shipped standard with blue ice packs. If you require dry ice shipping, please inform us in advance as additional charges may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial before opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
NMBR; Neuromedin-B receptor; NMB-R; Epididymis tissue protein Li 185a; Neuromedin-B-preferring bombesin receptor
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-390
Protein Length
Full length protein
Species
Homo sapiens (Human)
Target Names
Target Protein Sequence
MPSKSLSNLSVTTGANESGSVPEGWERDFLPASDGTTTELVIRCVIPSLYLLIITVGLLG NIMLVKIFITNSAMRSVPNIFISNLAAGDLLLLLTCVPVDASRYFFDEWMFGKVGCKLIP VIQLTSVGVSVFTLTALSADRYRAIVNPMDMQTSGALLRTCVKAMGIWVVSVLLAVPEAV FSEVARISSLDNSSFTACIPYPQTDELHPKIHSVLIFLVYFLIPLAIISIYYYHIAKTLI KSAHNLPGEYNEHTKKQMETRKRLAKIVLVFVGCFIFCWFPNHILYMYRSFNYNEIDPSL GHMIVTLVARVLSFGNSCVNPFALYLLSESFRRHFNSQLCCGRKSYQERGTSYLLSSSAV RMTSLKSNAKNMVTNSVLLNGHSMKQEMAL
Uniprot No.

Target Background

Function
Neuromedin-B receptor (NMBR) acts as a receptor for neuromedin-B.
Gene References Into Functions
  1. The rs2717 and rs6926279 within the NMBR gene have been associated with schizophrenia susceptibility. PMID: 27092952
  2. Hypoxia regulates the expression of the neuromedin B receptor through a mechanism dependent on hypoxia-inducible factor-1alpha. PMID: 24349381
Database Links

HGNC: 7843

OMIM: 162341

KEGG: hsa:4829

STRING: 9606.ENSP00000258042

UniGene: Hs.552106

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in epididymis (at protein level).

Q&A

What is Neuromedin B receptor (NMBR) and its physiological significance?

NMBR is a 7-transmembrane G protein-coupled receptor that binds neuromedin B (NMB), a bombesin-related peptide in mammals. The receptor functions as a key mediator in several physiological systems including respiratory, immune, and neuronal pathways. NMBR activation initiates several intracellular signaling cascades including phospholipase activation, calcium mobilization, and protein kinase C (PKC) activation, which ultimately lead to gene expression, DNA synthesis, or specific cellular responses such as secretion . Physiologically, NMBR contributes to smooth muscle contraction, neuronal responses, and regulation of cell growth, making it a significant target for research in multiple biological systems .

How is NMBR distributed throughout body tissues?

NMBR demonstrates specific anatomical distribution patterns that correlate with its diverse functions. Research has confirmed NMBR expression in several brain regions, most notably in olfactory and thalamic regions, as well as throughout gastrointestinal tissues . The receptor is also found in respiratory-related structures including the pre-Botzinger complex, a cluster of neurons in the ventrolateral medulla responsible for inspiration during respiratory activity . Additionally, NMBR is expressed in dorsal root ganglion neurons related to pain sensation and itch responses, and in Leydig cells where it influences steroidogenic processes . This distribution pattern provides critical insights for researchers designing tissue-specific studies.

What are the primary signaling mechanisms of NMBR?

NMBR signaling involves complex intracellular cascades typical of G-protein coupled receptors. Upon binding of the NMB ligand, NMBR activates multiple downstream pathways including phospholipase activation, intracellular calcium mobilization, and protein kinase C (PKC) activation . These processes ultimately regulate gene expression, cellular proliferation, and specific physiological responses. Gene ontology annotations identify NMBR's molecular function within both G protein-coupled receptor activity and specific bombesin receptor activity classes . The receptor is closely related to Class A/1 (Rhodopsin-like receptors) pathways and broader GPCR downstream signaling networks . For experimental work, researchers should note that understanding these pathways is essential for accurately interpreting receptor modulation effects.

How does NMBR differ from other bombesin receptors?

NMBR (BB1) belongs to the bombesin receptor family, which includes gastrin-releasing peptide receptor (GRPR or BB2) and an orphan receptor (BB3) . While these receptors share structural similarities as 7-transmembrane G-protein coupled receptors, they differ in ligand specificity, tissue distribution, and physiological functions. NMBR specifically binds neuromedin B with high affinity, while GRPR preferentially binds gastrin-releasing peptide (GRP) . Gene targeting studies have enabled researchers to distinguish the functional properties of NMBR from GRPR, revealing their distinct physiological roles . When designing selective targeting experiments, researchers should consider that GRPR is an important paralog of NMBR and may show overlapping functions in some systems . Molecular characterization studies using NMB-R-deficient mice have provided valuable insights into distinguishing the specific contributions of each receptor type.

What methods are recommended for studying NMBR expression?

For quantitative assessment of NMBR expression, real-time PCR (qRT-PCR) has been successfully employed to measure mRNA levels in various cellular models. Research protocols have demonstrated significant increases in NMBR mRNA expression at specific time points (6, 9, and 12 hours post-infection) in viral infection models . Western blot analysis provides protein-level confirmation of expression patterns, particularly useful when tracking temporal changes in receptor expression following experimental interventions . For cellular localization studies, immunofluorescent labeling techniques can identify specific cell populations expressing NMBR. When designing expression studies, it is advisable to include both mock-treated controls and multiple time points, as NMBR expression can change dynamically in response to experimental conditions .

How can researchers generate functional recombinant NMBR for in vitro studies?

Production of recombinant NMBR typically employs bacterial expression systems, with Escherichia coli being commonly used. Based on protocols for similar recombinant proteins, researchers should incorporate appropriate purification tags (such as the hexahistidine tag seen in related recombinant proteins: MGSSHHHHHHSSGLVPRGSHM) to facilitate isolation. Expression vectors should be designed to include the full coding sequence of human NMBR. For functional studies, it's critical to verify proper protein folding and membrane insertion, as NMBR is a transmembrane protein. When developing stable cell lines expressing NMBR, researchers should verify receptor functionality through ligand binding assays and downstream signaling activation measurements. For denatured protein applications suitable for antibody production or structural studies, expression methods yielding >85% purity are achievable with appropriate optimization .

What cellular models are most appropriate for NMBR functional studies?

Several cell lines have demonstrated utility in NMBR research. Human embryonic kidney (293T) cells and lung epithelial (A549) cells have successfully been used to study NMBR expression and function in virus infection models . For neuronal studies, trigeminal ganglion (TG) neurons provide an excellent model for investigating NMBR's role in sensory processing and pain perception . When selecting cellular models, researchers should consider natural expression levels of both NMBR and its ligand NMB. For mechanistic studies, NMBR-knockdown cell lines generated using shRNA techniques offer valuable tools for investigating receptor-specific effects . Primary cultures from tissues known to express NMBR, such as gastrointestinal epithelium or specific brain regions, may provide more physiologically relevant models for certain research questions.

How can NMBR activity be accurately measured in experimental settings?

Multiple complementary approaches can be employed to measure NMBR activity. Patch clamp recording techniques have successfully demonstrated NMBR-mediated effects on ion channels, particularly the enhancement of T-type calcium channel currents (IT) in trigeminal ganglion neurons . For signaling studies, measuring intracellular calcium mobilization provides a rapid assessment of receptor activation. Downstream effects of NMBR activation can be quantified through enzyme-linked immunosorbent assays (ELISA) measuring regulated cytokines or hormones . Functional outcomes of NMBR activation, such as smooth muscle contraction or cell proliferation, should be measured using tissue-appropriate assays. When designing activity assays, researchers should include appropriate positive controls (NMB agonist) and negative controls (NMBR antagonists) to confirm specificity .

How does NMBR contribute to innate immunity and viral defense mechanisms?

Recent research has uncovered an important role for the NMB/NMBR system in innate immune responses, particularly against influenza A virus infection. Experimental evidence demonstrates that NMB enhances interferon alpha (IFN-α) expression while reducing expression of viral nucleoprotein (NP) and interleukin-6 (IL-6) in infected cells and animal models . This suggests a protective role in antiviral defense. The mechanism appears to involve transcriptional regulation of key immune mediators, as NMB/NMBR signaling modifies cytokine expression patterns in response to viral challenge .

For researchers studying this pathway, it is recommended to:

  • Measure NMB and NMBR expression at multiple time points post-infection

  • Assess changes in IFN-α, NP, and IL-6 expression as functional outcomes

  • Compare NMBR agonist and antagonist effects to establish causality

  • Validate in vitro findings with appropriate animal models

This emerging role positions NMBR as a potential target for developing novel antiviral therapeutics with host-directed mechanisms rather than direct viral targeting .

What methodologies best reveal NMBR's role in neuronal calcium signaling and pain pathways?

NMBR plays a significant role in sensory neuronal excitability and peripheral pain sensitivity through its modulation of calcium channels. Research has established that NMB reversibly and concentration-dependently increases T-type calcium channel currents in small-sized trigeminal ganglion neurons via NMBR activation . To investigate these mechanisms, researchers should employ:

  • Patch clamp recording to directly measure calcium currents in response to NMBR activation

  • Western blot analysis to quantify expression levels of relevant calcium channels

  • Adenovirus-mediated shRNA knockdown to establish specificity of NMBR effects

  • Animal behavior tests to correlate cellular findings with pain sensitivity outcomes

The specific interaction between NMBR and Cav3.2 T-type channels appears particularly important for nociceptive signaling, making this an important area for researchers investigating neuronal mechanisms of pain . When designing experiments in this area, controlling for indirect effects through other signaling pathways is critical for establishing direct NMBR-mediated mechanisms.

How do NMBR polymorphisms influence disease susceptibility and treatment response?

Genetic variation in NMBR has been associated with disease susceptibility, most notably with schizophrenia . Research investigating these associations requires careful genotyping and phenotyping approaches. For studies examining NMBR polymorphisms, researchers should consider:

  • Comprehensive sequencing of the NMBR gene (located at chromosomal position previously identified as GC06M142019)

  • Correlation analysis between specific polymorphisms and disease phenotypes

  • Functional characterization of variant receptors using cell-based signaling assays

  • Population stratification to account for ethnic differences in polymorphism frequency

Understanding how specific genetic variations affect receptor function, expression, or ligand binding provides valuable insights into disease mechanisms and potential personalized treatment approaches. Research suggests that polymorphisms may alter signaling efficacy or tissue-specific expression patterns, potentially influencing an individual's response to NMBR-targeted therapeutics .

What experimental approaches reveal NMBR's role in respiratory regulation?

NMBR signaling contributes to critical respiratory functions, particularly in sighing and sneezing responses. Research has established that NMB induces sighing by acting directly on NMBR-expressing neurons in the pre-Botzinger complex, a brainstem region responsible for inspiration . Additionally, NMBR signaling contributes to sneezing following exposure to chemical irritants or allergens .

For investigating these mechanisms, researchers should employ:

  • Tissue-specific receptor expression analysis focusing on respiratory control centers

  • Electrophysiological recordings of neuronal activity in response to NMB

  • Targeted genetic approaches (conditional knockouts or knockdowns) in specific neuronal populations

  • Whole-animal respiratory measurements following NMBR modulation

These studies require careful integration of molecular, cellular, and physiological techniques. When designing experiments, researchers should consider that respiratory effects may involve multiple neurocircuits and could be influenced by other bombesin-related peptide systems, necessitating specific controls for distinguishing NMBR-mediated effects .

How can researchers develop selective NMBR agonists and antagonists?

Developing highly selective NMBR modulators presents significant challenges due to structural similarities with other bombesin receptors. Research approaches should include:

  • Structure-activity relationship studies to identify chemical modifications that enhance NMBR selectivity

  • Comparative binding assays using all bombesin receptor subtypes to confirm specificity

  • Functional assays measuring downstream signaling to verify biological activity

  • Docking studies utilizing the seven-transmembrane structure of NMBR to predict binding interactions

Successful NMBR antagonist development has therapeutic potential for inhibiting tumor cell growth and modulating other NMBR-mediated processes . When designing selective compounds, researchers should systematically test cross-reactivity with GRPR and other structurally related receptors. The evaluation should include both binding affinity measurements and functional activity assays to ensure true selectivity in biological systems.

What are the challenges in translating NMBR research from cellular models to in vivo systems?

Translational research involving NMBR faces several methodological challenges. Researchers should consider:

  • Tissue-specific expression patterns that may create variable responses across organ systems

  • Compensatory mechanisms in knockout models that may mask phenotypes

  • Species differences in receptor pharmacology between human and animal models

  • Limitations in compound delivery to specific NMBR-expressing tissues

To address these challenges, research approaches should include conditional and inducible genetic models, careful pharmacokinetic analysis of NMBR modulators, and multiple complementary methodologies to validate findings . When designing in vivo experiments, researchers should include appropriate controls for potential off-target effects and consider the temporal dynamics of NMBR expression, which can change in response to experimental conditions or disease states .

How should researchers interpret conflicting data on NMBR function across different tissue systems?

NMBR demonstrates diverse and sometimes seemingly contradictory functions across different tissues and physiological contexts. For example, NMBR activation promotes cell proliferation in some tissues while potentially inhibiting inflammatory responses in others . To address these complexities, researchers should:

  • Carefully define the specific cellular context being studied

  • Consider the influence of co-expressed receptors and interacting proteins

  • Evaluate the complete signaling network rather than isolated pathways

  • Account for potential compensatory mechanisms in genetic models

Comparative studies using the same experimental approaches across different tissues can help resolve apparent discrepancies. When interpreting conflicting results, researchers should consider that NMBR may couple to different G-protein subtypes or activate distinct signaling cascades depending on the cellular environment and receptor expression levels .

What emerging technologies show promise for advancing NMBR research?

Several cutting-edge approaches are enhancing NMBR research capabilities:

  • CRISPR-Cas9 genome editing for generating precise receptor modifications

  • Single-cell RNA sequencing to identify specific NMBR-expressing cell populations

  • Optogenetic and chemogenetic tools for temporally controlled receptor modulation

  • Advanced imaging techniques for visualizing receptor trafficking and signaling dynamics

These technologies allow unprecedented precision in studying NMBR function. For example, CRISPR-based approaches can introduce specific polymorphisms identified in human populations, allowing direct testing of their functional consequences . When incorporating these advanced approaches, researchers should develop appropriate validation strategies to confirm specificity and establish clear connections between molecular interventions and physiological outcomes .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.