Recombinant Human Neuromedin-K receptor (TACR3)

Shipped with Ice Packs
In Stock

Description

Molecular and Functional Characteristics

TACR3 is encoded by the TACR3 gene (Chromosome 4q24 in humans), spans seven transmembrane domains, and activates phospholipase C via Gq/11 proteins upon ligand binding . Recombinant TACR3 is produced in heterologous expression systems (e.g., HEK293 cells) to study its structure-function relationships and signaling pathways. Key features include:

PropertyDetails
Ligand SpecificityNeurokinin B (NKB) > Neurokinin A > Substance P
Signaling PathwayGq/11-mediated calcium flux and PKC activation
Tissue DistributionCentral nervous system (hippocampus, hypothalamus), peripheral neurons, tumors
Recombinant ApplicationsRadioligand binding assays, calcium imaging, ELISA, drug screening

Research Applications

Recombinant TACR3 is pivotal in advancing neuroscience and drug discovery:

  • Neurological Disorders: Studies link TACR3 dysfunction to anxiety, depression, and impaired long-term potentiation (LTP). Recombinant models show that TACR3 inhibition increases hippocampal spine density but disrupts LTP, reversible by testosterone .

  • Cancer Biology: Overexpression in oral squamous cell carcinoma (OSCC) correlates with tumor invasiveness, particularly in bone-invading fronts .

  • Endocrinology: Mutations in TACR3 cause hypogonadotropic hypogonadism due to impaired NKB signaling in gonadotropin-releasing hormone (GnRH) regulation .

Pharmacological Tools

Recombinant TACR3 enables the characterization of ligands:

CompoundTypeAffinity (Ki)Application
SenktideAgonist0.2 nMNeuronal excitability studies
SB-222,200Antagonist4.4 nMAnxiety and pain models
ElinzanetantAntagonist<1 nMClinical trials for menopausal symptoms

Assay Development

The Human TACR3 ELISA Kit (Assay Genie) exemplifies recombinant protein utility, offering:

ParameterSpecification
Detection Range15.6–1,000 pg/mL
Sample TypesSerum, plasma, cell culture supernatants
Sensitivity2.3 pg/mL
Cross-Reactivity<0.1% with TACR1 or TACR2

Pathological Associations

Recombinant TACR3 models reveal mechanistic insights into diseases:

ConditionTACR3 RoleReference
Hypogonadotropic HypogonadismLoss-of-function mutations impair GnRH release, corrected by NKB analogs
OSCC ProgressionTACR3 overexpression in bone-invading tumor cells enhances invasiveness
Anxiety DisordersHippocampal TACR3 downregulation elevates spine density and CaMKII activity

Challenges and Innovations

  • Expression Systems: Optimizing full-length TACR3 in mammalian cells remains challenging due to post-translational modifications .

  • Therapeutic Targeting: NK3R antagonists (e.g., fezolinetant) show promise in treating menopausal hot flashes but require precise receptor subtype selectivity .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and arranged in advance; additional charges apply.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to ensure contents settle. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If a specific tag type is required, please inform us, and we will prioritize its development.
Synonyms
TACR3; NK3R; TAC3R; Neuromedin-K receptor; NKR; NK-3 receptor; NK-3R; Neurokinin B receptor; Tachykinin receptor 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-465
Protein Length
Full length protein
Species
Homo sapiens (Human)
Target Names
Target Protein Sequence
MATLPAAETWIDGGGGVGADAVNLTASLAAGAATGAVETGWLQLLDQAGNLSSSPSALGL PVASPAPSQPWANLTNQFVQPSWRIALWSLAYGVVVAVAVLGNLIVIWIILAHKRMRTVT NYFLVNLAFSDASMAAFNTLVNFIYALHSEWYFGANYCRFQNFFPITAVFASIYSMTAIA VDRYMAIIDPLKPRLSATATKIVIGSIWILAFLLAFPQCLYSKTKVMPGRTLCFVQWPEG PKQHFTYHIIVIILVYCFPLLIMGITYTIVGITLWGGEIPGDTCDKYHEQLKAKRKVVKM MIIVVMTFAICWLPYHIYFILTAIYQQLNRWKYIQQVYLASFWLAMSSTMYNPIIYCCLN KRFRAGFKRAFRWCPFIKVSSYDELELKTTRFHPNRQSSMYTVTRMESMTVVFDPNDADT TRSSRKKRATPRDPSFNGCSRRNSKSASATSSFISSPYTSVDEYS
Uniprot No.

Target Background

Function

This protein is a receptor for the tachykinin neuropeptide neuromedin-K (neurokinin B). It couples to G proteins, activating a phosphatidylinositol-calcium second messenger system. The receptor exhibits the following affinity ranking for tachykinins: neuromedin-K > substance K > substance P.

Gene References Into Functions
  1. Genetic variation in the TACR3 gene has been associated with vasomotor menopause symptoms, particularly through SNPs on chromosome 4. (PMID: 28231077)
  2. Interspecies variations exist in neurokinin 3 receptor brain localization, with humans exhibiting higher binding in the amygdala and hypothalamus. (PMID: 26993630)
  3. High NK-3R expression is linked to oral squamous cell carcinoma. (PMID: 29061792)
  4. Reduced NK-3R expression has been observed in polycystic ovary syndrome granulosa cells. (PMID: 27580802)
  5. Neurokinin-3 receptor (NK3R) ligands are considered in regulating the reproductive axis. (PMID: 27271543)
  6. Peripheral sensory nerve-derived TAC3 may influence gingival oral squamous cell carcinoma cells via TACR3 in the bone matrix. (PMID: 27919954)
  7. While not directly linked to puberty onset, the A63P SNP in TAC3 shows association with precocious puberty. (PMID: 25153567)
  8. Elevated C-reactive protein (CRP) may contribute to preeclampsia by binding to phosphocholinated neurokinin B and preferentially activating NK3R. (PMID: 25452470)
  9. TACR3 gene mutations are not a frequent cause of idiopathic central precocious puberty (ICPP). (PMID: 24434351)
  10. Studies investigate the molecular mechanisms underlying NK3R mutations in GnRH deficiency. (PMID: 24376026)
  11. Increased TACR3 gene expression is observed in leiomyomas compared to myometrium. (PMID: 23656837)
  12. The rs2765 SNP in TACR3 is associated with learning and memory impairment in elderly patients with cognitive deficits. (PMID: 23983264)
  13. TACR3 and GNRHR mutations are among the most common causes of normosmic idiopathic hypogonadotropic hypogonadism in Turkish families. (PMID: 22766261)
  14. A case study reveals hypothalamic dysfunction as a primary cause of idiopathic hypogonadotropic hypogonadism in patients with biallelic TACR3 mutations. (PMID: 20395662)
  15. NK-3R plays a crucial role in hypothalamic gonadotropin-releasing hormone release. (PMID: 20194706)
  16. No significant difference in tachykinin receptor expression was found between pre-eclamptic and normal placentas. (PMID: 16709596)
  17. TACR3 is unlikely associated with schizophrenia development in the Japanese population. (PMID: 18287949)
  18. SNPs in the 3' region of TACR3 show association with alcohol dependence. (PMID: 18422838)
  19. TAC3 and TACR3 mutations in familial hypogonadotropic hypogonadism highlight Neurokinin B's role in reproductive control. (PMID: 19079066)
  20. The TACR3 His148Leu mutation causes impaired sexual maturation, with significantly reduced receptor signaling in vitro. (PMID: 19755480)
Database Links

HGNC: 11528

OMIM: 162332

KEGG: hsa:6870

STRING: 9606.ENSP00000303325

UniGene: Hs.942

Involvement In Disease
Hypogonadotropic hypogonadism 11 with or without anosmia (HH11)
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is TACR3 and what are its structural characteristics?

TACR3 (Tachykinin Receptor 3) belongs to the tachykinin receptor family of G protein-coupled receptors (GPCRs) within the rhodopsin subfamily . It functions by binding to its high-affinity ligand, neurokinin B (NKB) .

Structurally, TACR3 is characterized by:

  • Seven hydrophobic transmembrane domains

  • Association with G proteins that activate phosphatidylinositol-calcium second messenger systems

  • A protein sequence of approximately 300-302 amino acids (species dependent)

Methodology for structural characterization:

  • Bioinformatic analysis using tools such as TMHMM Server v. 2.0 for transmembrane domain prediction

  • Cloning and sequence analysis with BioEdit software

  • Phylogenetic analysis using MEGA 6.0 with the neighbor-joining method

Where is TACR3 primarily expressed in mammalian systems?

TACR3 shows distinct expression patterns across various tissues:

Brain regions with high TACR3 expression:

  • Hippocampus, particularly the ventral region

  • Hypothalamus

  • Amygdala and cortex

  • Midbrain structures

  • Substantia nigra

Peripheral expression:

  • Reproductive tissues

  • Evidence of expression in oral squamous cell carcinoma

Methods for detecting TACR3 expression:

  • In situ hybridization for mRNA localization

  • Immunohistochemistry for protein localization

  • RT-PCR for quantitative expression analysis

  • Western blotting for protein quantification

What is the relationship between TACR3 and reproductive function?

TACR3 plays a critical role in reproductive physiology:

Reproductive phenotypes associated with TACR3 dysfunction:

  • Hypogonadotropic hypogonadism with or without anosmia

  • Delayed or absent sexual maturation

  • Subfertility in animal models

Mechanistic data:

  • Mutations in TACR3 are associated with GnRH deficiency

  • TACR3 modulates gonadotropin release through its action on Kisspeptin-1 neurons in the hypothalamus

  • In Tacr3-/- mice, females showed:

    • Abnormal estrous cyclicity (86.8% time in diestrus vs. 52.5% in wild-type)

    • Reduced uterine weight

    • Absence of corpora lutea in approximately 50% of females

  • In Tacr3-/- mice, males showed:

    • Smaller testes (159 ± 11 mg vs. 208 ± 11 mg in wild-type)

    • Lower FSH levels (9.9 ± 0.7 ng/ml vs. 28.9 ± 2.0 ng/ml in wild-type)

Research approaches:

  • Knockout mouse models

  • Histological analysis of reproductive tissues

  • Hormone assays (FSH, LH, testosterone)

  • Fertility testing through breeding experiments

What methodologies are most effective for studying TACR3-mediated neuronal signaling?

The study of TACR3-mediated neuronal signaling requires specialized techniques:

Electrophysiological approaches:

  • Multielectrode arrays to measure neuronal cross-correlation and firing patterns

  • Recording of long-term potentiation (LTP) in hippocampal slices

Molecular signaling assessment:

  • Analysis of CaMKII activation status

  • AMPA receptor phosphorylation measurement

  • G protein coupling analysis

Morphological analysis:

  • Spine density quantification using microscopy

  • Dendritic arborization measurements

Pharmacological tools:

  • Osanetant (TACR3 antagonist) for in vivo and in vitro studies

  • Administration protocols:

    • Intraperitoneal injection: 5 mg/kg dose

    • Intracerebroventricular delivery: 100 nM via osmotic minipumps

    • In vitro application to neuronal cultures

How does TACR3 interact with testosterone and what are the implications for anxiety regulation?

Recent research has revealed a complex relationship between TACR3, testosterone levels, and anxiety:

Key findings:

  • Male rats with high anxiety show reduced TACR3 expression in the ventral hippocampus

  • TACR3 expression increases substantially during male sexual development, coinciding with elevated testosterone and reduced anxiety

  • Deficient TACR3 activity leads to lower serum testosterone levels

  • Testosterone treatment increases TACR3 expression in the hippocampus

Experimental evidence:

  • Testosterone propionate treatment (5 mg/kg/day for 5 days) significantly alters hippocampal TACR3 expression

  • TACR3 inhibition through osanetant affects spine density and synaptic connectivity

  • The firing pattern in response to LTP induction is inadequate in neurons expressing defective TACR3, which can be corrected with testosterone treatment

Methodological approaches:

  • Behavioral testing for anxiety assessment

  • Serum testosterone measurements following treatments:

    • Testosterone Parameter Assay Kit (R&D Systems)

    • Competitive Immunoassay using direct chemiluminescent Technology

  • Western blot analysis of TACR3 expression

TreatmentEffect on TACR3 ExpressionEffect on TestosteroneEffect on Anxiety
Testosterone administrationIncreasedIncreasedDecreased
Osanetant (TACR3 inhibitor)N/ADecreasedIncreased
TACR3 deficiencyReducedDecreasedIncreased

What are the species-specific differences in TACR3 structure and function?

TACR3 shows notable evolutionary conservation but with important species-specific variations:

Comparative structural features:

  • In Japanese eel (Anguilla japonica):

    • Two tac3 genes (tac3a, tac3b) encode different NKB peptides

    • A single tacr3 gene with a premature stop codon

    • This mutation appears conserved across multiple eel species

  • In mammals:

    • Human TACR3: Located on chromosome 4q24, contains 5 exons

    • Rat Tacr3: Shows expression patterns that fluctuate with hormonal status

    • Mouse Tacr3: Knockout models show subfertility but not complete infertility

Functional differences:

  • Humans with TACR3 mutations exhibit complete GnRH deficiency and hypogonadism

  • Tacr3-/- mice show milder phenotypes with subfertility rather than infertility

  • This phenotypic discordance between species suggests differential compensation mechanisms

Research approaches:

  • Cross-species sequence alignment

  • Phylogenetic analysis

  • Comparative phenotyping of knockout/mutant models

  • RACE-PCR for species-specific gene cloning

How does TACR3 affect synaptic plasticity and what are the underlying mechanisms?

TACR3 plays a significant role in regulating synaptic function:

Effects on synaptic structures:

  • TACR3 inhibition is associated with:

    • Increased spine density

    • Enhanced AMPA receptor phosphorylation

    • Stronger cross-correlation of neuronal firing

  • Functional TACR3 expression in spines results in:

    • Spine shrinkage and pruning

    • Regulation of long-term potentiation (LTP)

Molecular pathways:

  • TACR3 modulation significantly influences CaMKII activation

  • TACR3 is expressed in presynaptic compartments and affects synaptic activity

  • TACR3 dysfunction impairs LTP in the dentate gyrus

Methodological considerations:

  • Electrophysiological recordings using multielectrode arrays

  • Analysis of synaptic protein phosphorylation status

  • Morphological analysis of dendritic spines

  • LTP induction protocols for functional assessment

What strategies should be considered when designing TACR3-targeted therapeutic interventions?

Developing interventions targeting TACR3 requires consideration of multiple factors:

Therapeutic potential:

  • Anxiety disorders: TACR3 modulation affects anxiety-related behaviors

  • Reproductive disorders: Potential for treating hypogonadotropic hypogonadism

  • Neurological conditions: Possible applications in Alzheimer's and Parkinson's diseases

Intervention approaches:

  • TACR3 antagonists (e.g., osanetant)

  • Testosterone supplementation to modulate TACR3 expression or compensate for its dysfunction

  • Targeted delivery to specific brain regions (e.g., ventral hippocampus)

Considerations for experimental design:

  • Sex differences in TACR3 expression and function

  • Age-dependent effects (developmental vs. adult)

  • Potential off-target effects on other tachykinin receptors

  • Route of administration (peripheral vs. central)

Assessment methods:

  • Behavioral testing for anxiety and reproductive parameters

  • Hormone level monitoring

  • Electrophysiological recordings for neural activity

  • Histological and molecular analysis of target tissues

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.