Recombinant Human Neuronal acetylcholine receptor subunit alpha-5 (CHRNA5)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it when placing your order, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, temperature, and the inherent stability of the protein.
Typically, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize its development.
Synonyms
CHRNA5; NACHRA5; Neuronal acetylcholine receptor subunit alpha-5
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
23-468
Protein Length
Full Length of Mature Protein
Species
Homo sapiens (Human)
Target Names
CHRNA5
Target Protein Sequence
RCGLAGAAGGAQRGLSEPSSIAKHEDSLLKDLFQDYERWVRPVEHLNDKIKIKFGLAISQ LVDVDEKNQLMTTNVWLKQEWIDVKLRWNPDDYGGIKVIRVPSDSVWTPDIVLFDNADGR FEGTSTKTVIRYNGTVTWTPPANYKSSCTIDVTFFPFDLQNCSMKFGSWTYDGSQVDIIL EDQDVDKRDFFDNGEWEIVSATGSKGNRTDSCCWYPYVTYSFVIKRLPLFYTLFLIIPCI GLSFLTVLVFYLPSNEGEKICLCTSVLVSLTVFLLVIEEIIPSSSKVIPLIGEYLVFTMI FVTLSIMVTVFAINIHHRSSSTHNAMAPLVRKIFLHTLPKLLCMRSHVDRYFTQKEETES GSGPKSSRNTLEAALDSIRYITRHIMKENDVREVVEDWKFIAQVLDRMFLWTFLFVSIVG SLGLFVPVIYKWANILIPVHIGNANK
Uniprot No.

Target Background

Function
Upon binding acetylcholine, the AChR undergoes a significant conformational change that affects all subunits and leads to the opening of an ion-conducting channel across the plasma membrane.
Gene References Into Functions
  1. Glutamatergic N398 neurons exhibited increased frequency and amplitude in response to lower nicotine doses (0.1 μM), but they also showed rapid desensitization, consistent with previous analyses of N398-associated nicotinic receptor function. PMID: 27698409
  2. Enhanced habenula-striatum functional connectivity may be influenced by the nicotinic receptor variant rs16969968 and potentially contribute to increased opioid use. PMID: 28857330
  3. Our current study suggested that rs667282 in CHRNA5-A3 may modify the prognosis of patients with advanced non-small cell lung cancer. PMID: 27050379
  4. The data replicate previous findings suggesting CHRNA5 as a candidate gene for chronic obstructive pulmonary disease (COPD), with rs8040868 identified as a risk variant for COPD development in the Swedish population. PMID: 27835950
  5. Polymorphisms in the CHRNA5 and NRXN1 genes were linked to greater cigarette consumption in a Mexican Mestizo population. PMID: 27355804
  6. RP11-650L12.2 rs149941240 polymorphism was associated with the risk of colorectal cancer. PMID: 28442398
  7. We identified that other patients exhibited mutations in genes not previously associated with Rett syndrome or other neurodevelopmental disorders, such as the ankyrin repeat containing protein ANKRD31 or the neuronal acetylcholine receptor subunit alpha-5 (CHRNA5). PMID: 27541642
  8. Quitting smoking demonstrates significant benefits in reducing lung cancer risks for smokers regardless of their CHRNA5 rs16969968 genetic risk status. Smokers with high-risk CHRNA5 genotypes can substantially mitigate their elevated genetic risk for lung cancer by quitting smoking, reducing their lung cancer risk by half and delaying its onset by 7 years for those who develop it. PMID: 27543155
  9. The study revealed that multiple rare, low frequency, and common variants in the CHRNA5 gene contribute to the development of nicotine dependence. PMID: 26239294
  10. Our meta-analysis provided statistical evidence for a strong association between the rs16969968 polymorphism and the risk of lung cancer, particularly in smokers and Caucasians. PMID: 26434895
  11. rs2036527 is a risk factor for smoking exposure and lung cancer association in African-Americans. PMID: 26981579
  12. Preventive interventions in adolescents reduced the genetic risk for smoking associated with the rs16969968 CHRNA5 variant. PMID: 25941207
  13. Findings suggest that gene variance in the CHRNA5-CHRNA3-CHRNB4 cluster is associated with an increased risk of death, incidence of COPD, and tobacco-related cancer in smokers. PMID: 26689306
  14. These results suggest that exposure to nicotine might negatively impact the apoptotic potential of chemotherapeutic drugs, and that alpha5-nAChR/AKT signaling plays a key role in the anti-apoptotic activity of nicotine induced by cisplatin. PMID: 26909550
  15. A novel regulatory SNP association with nicotine dependence was discovered. Previously observed differences in CHRNA5 mRNA expression and nicotine dependence risk were linked to underlying DNA methylation differences. PMID: 26220977
  16. This study showed that CHRNA5(rs16969968) interacted with chronic low family support in association with child mental health status. PMID: 26228411
  17. No associations were found between the analyzed variants and smoking. However, there was an association among non-smoking subjects between the A allele of rs16969968 and high body mass index. PMID: 26757861
  18. In non-Hispanic White participants, a novel association between rs1289899 in the CHRNA5 gene and posttraumatic stress disorder was observed. PMID: 26184988
  19. A low to moderate level of Nicotine Dependence in the Kashubians, of Poland, influenced by age, sex, as well as the CHRNA5 rs16969968 variant was demonstrated. PMID: 25652844
  20. Results indicate that the minor alleles of both polymorphisms modulate response speed in a sex-dependent, diametrically opposed manner. PMID: 25674902
  21. The CHRNA5 genetic risk synergized the effect of partner smoking, producing an especially low likelihood of successful smoking reduction in two complementary studies. PMID: 25073833
  22. CHRNA5 rs3841324 combined variant genotypes (ins/del+del/del) had a >1.5-fold elevated risk for nasopharyngeal carcinoma. PMID: 25329654
  23. Genetic variation in CHRNA5 protein influences smoking behaviors and the level of carbon monoxide. PMID: 25072098
  24. CHRNA5 SNPs predicted nicotine deprivation-induced reduction in cognitive control. PMID: 24934182
  25. Among smokers hospitalized with acute myocardial infarction, the high-risk CHRNA5 allele was associated with a lower likelihood of quitting before hospitalization and significantly less abstinence 1 year after hospitalization with MI. PMID: 24727484
  26. The effect of nicotine replacement on continuous abstinence is moderated by the combined genetic risks from CYP2A6 and CHRNA5. PMID: 24033696
  27. Single nucleotide polymorphism in CHRNA5 is associated with lung cancer. PMID: 25187487
  28. Data found that DRD2 rs1076560 and CHRNA5 rs16969968 interact to modulate cognitive function, prefrontal physiology during working memory, and prefrontal gray matter volume. PMID: 24819610
  29. In African-Americans, variants (common or rare) in genes other than CHRNA5 are more likely to contribute to the nicotine-dependent phenotype. PMID: 24682045
  30. Substance dependence-associated variants have a direct cis-regulatory effect on CHRNA5 transcript levels in human frontal cortices of African and European ancestry. PMID: 24303001
  31. Among African Americans, CHRNA5-A3-B4 variants are not associated with smoking but can influence smoking abstinence. PMID: 24733007
  32. The present study investigated the association of CHRNA5 polymorphisms and smoking topography. PMID: 23358500
  33. The heterozygous genotype c.-166T>A at rs503464 of CHRNA5 may be associated with a reduced risk of lung cancer, thus representing a susceptibility allele in Chinese individuals. PMID: 23314339
  34. Silencing of alpha5-nAChR significantly inhibits nicotine-induced cell proliferation in tumor cell lines. PMID: 24793809
  35. Women with the variant AA genotype of CHRNA5 rs16969968 or variant CC genotype of LOC123688 rs8034191 were at significantly increased risk of heavy smoking. PMID: 21810735
  36. The alpha5 subunit can occupy the position of a nonbinding subunit, or replace a beta2 subunit participating in a canonical binding site. PMID: 24184962
  37. CHRNA5 polymorphism was associated with pack-year of smoking in chronic obstructive pulmonary disease Chinese Han patients. PMID: 22914670
  38. Evaluated the association between CHRNA5-A3-B4 gene cluster variants (rs667282 and rs3743073, two variants modifying lung cancer risk) and risk of gastric cancer. PMID: 23576140
  39. The rs588765 nicotine dependence risk allele 'C' was associated with delayed age at onset among ever-smokers (even when smoking intensity variables are accounted for), but had no significant effect among never smokers. PMID: 22884254
  40. Our findings provide evidence for the presence of multiple CHRNA5 mRNA isoforms that may modulate the multimeric nicotine receptor and cis-regulatory variations in the CHRNA5 locus that act in vivo in the control of CHRNA5 mRNA expression. PMID: 23430818
  41. Single-nucleotide polymorphism in the CHRNA5 gene is associated with lung cancer susceptibility. PMID: 23221128
  42. Findings of this study suggest that personality measures may play an important role in substance use disorders at both environmental (marriage) and genetic rs16969968 in CHRNA5 levels. PMID: 23308091
  43. Nicotinic acetylcholine receptor single nucleotide polymorphism is associated with response to smoking cessation therapies. PMID: 23249876
  44. The intronic rs871058, which is highly correlated with rs16969968 in CHRNA5, while showing a modest treatment effect for subjects possessing the rare allele, has a large effect for non-carriers. PMID: 23061658
  45. Results showed that several polymorphisms and their haplotypes in CHRNA5/CHRNA3 genes may have functional effects on (i) CHRNA5 mRNA levels, (ii) polycyclic aromatic hydrocarbon-DNA adduct levels, and (iii) susceptibility to lung cancer. PMID: 23011884
  46. alpha3beta4alpha5 nicotinic acetylcholine receptors, expressing the the N398 variant of CHRNA5, exhibit a reduced response to agonists when extracellular calcium is high, which may lead to distinct downstream cellular signaling. PMID: 22820273
  47. Two specific aspects of executive functioning related to drug addiction – impulsivity and working memory – are demonstrated in transgenic mice overexpressing alpha3/alpha5/beta4 nicotinic receptor subunits. PMID: 22024278
  48. The A allele of the single nucleotide polymorphism rs16969968 (alpha5, G > A), which correlates with the development of lung cancer, shows a non-significant trend to be associated with cervical lesions. PMID: 22406075
  49. Results suggest a significant role for CHRNA5 variants as a genetic risk factor for airflow obstruction, potentially independent of smoking status. PMID: 22837378

Show More

Hide All

Database Links

HGNC: 1959

OMIM: 118505

KEGG: hsa:1138

STRING: 9606.ENSP00000299565

UniGene: Hs.1614

Protein Families
Ligand-gated ion channel (TC 1.A.9) family, Acetylcholine receptor (TC 1.A.9.1) subfamily, Alpha-5/CHRNA5 sub-subfamily
Subcellular Location
Cell junction, synapse, postsynaptic cell membrane; Multi-pass membrane protein. Cell membrane; Multi-pass membrane protein.

Q&A

What is the genomic organization of CHRNA5 and its relationship to adjacent genes?

The CHRNA5 gene is located on chromosome 15q25.1 in humans, forming part of a functionally related gene cluster that includes CHRNA3 and CHRNB4 . This gene cluster spans approximately 500 kb (GRCh38: 15:78428191-78906250) and contains 20 genes total - 8 protein-coding and 12 non-coding genes . The cluster represents a local regulome with coordinated expression patterns.

Methodologically, researchers investigating this region should consider:

  • Using chromosome conformation capture (3C) techniques to identify DNA looping between enhancers and multiple promoters

  • Analyzing linkage disequilibrium (LD) structures across the region, as high LD makes identification of causative variants challenging

  • Examining both coding and non-coding elements, including the antisense RNA RP11-650L12.2 that shows co-expression with CHRNA5

How is CHRNA5 expression regulated across different tissues?

CHRNA5 exhibits tissue-specific expression patterns with distinct regulatory mechanisms. Expression analysis shows CHRNA5 is expressed in multiple brain regions and peripheral tissues, often co-expressed with CHRNA3 and the antisense RNA RP11-650L12.2 .

The following methodological approaches are recommended for studying CHRNA5 expression:

  • Utilize RNA-seq data from resources like GTEx to evaluate tissue-specific expression profiles

  • Examine eQTL data, as different SNPs may regulate expression in different tissues

  • Consider the enhancer haplotype tagged by rs880395, which significantly increases CHRNA5 mRNA expression (approximately four-fold) in brain tissues

  • Analyze tissue-specific transcription factor binding and chromatin accessibility

What experimental models are most appropriate for studying CHRNA5 knockout phenotypes?

Several experimental models have been validated for studying CHRNA5 function, each with specific advantages:

In vivo rodent models:

  • CHRNA5 knockout (KO) mice exhibit increased nicotine consumption compared to wildtype littermates, making them valuable for addiction studies

  • These models show impaired attentional performance in cognitive tasks, useful for studying attention mechanisms

  • Chromosome substitution strains (CSS) with CHRNA5 KO can identify genetic modifiers of nicotine consumption behavior

Recommended methodological protocols:

  • For nicotine consumption studies: Use two-bottle choice tests measuring free-choice oral consumption over multiple days

  • For attention assessment: Implement the five-choice serial reaction task, where animals must encode and recall the location of a light stimulus

  • For genetic modifier identification: Introgress the CHRNA5 KO mutation onto different genetic backgrounds using the breeding strategy outlined in Figure 1 from the literature

How do enhancer variants influence CHRNA5 expression across different tissues?

The CHRNA5 enhancer haplotype (tagged by rs880395) significantly impacts gene expression through complex regulatory mechanisms. This effect varies by tissue and extends beyond CHRNA5 itself:

Tissue-specific regulatory effects:

  • In skeletal muscle: The enhancer SNPs represent the most significant eQTL for CHRNA5 (p=2.8e-91, effect size=-1.1)

  • In all tissues: The enhancer increases not only CHRNA5 mRNA expression but also enhances RP11-650L12.2 and CHRNA3 expression

  • In nucleus accumbens and putamen: CHRNA3 expression uniquely associates with a different haplotype (tagged by rs1948)

Methodological approaches for enhancer analysis:

  • Plot eQTL p-values against linkage disequilibrium (LD) metrics to identify causative variants

  • Employ chromosome conformation capture techniques to detect DNA looping between enhancers and promoters

  • Use CRISPR-based approaches to verify enhancer function through targeted mutation

What statistical methods best identify causative regulatory variants in the CHRNA5 locus?

The high linkage disequilibrium across the CHRNA5/CHRNA3/CHRNB4 cluster (spanning >200kb) presents challenges for identifying causative variants. Researchers should implement these methodological approaches:

  • Correlate eQTL p-values with LD metrics (R²) to the highest scoring SNP

  • Analyze correlation strength between eQTL significance and LD - strong correlations (r² 0.68–0.92) suggest a single causative variant

  • Compare tissue-specific effects to identify distinct regulatory mechanisms

  • Utilize conditional analysis to distinguish independent effects

Data interpretation example:
When analyzing eQTL data for CHRNA5 and CHRNA3 in skeletal muscle and nucleus accumbens, plot p-values against LD to the top SNP to visualize regulatory relationships. In nucleus accumbens, rs1948 associates with CHRNA3 expression while rs880395 affects multiple genes in most tissues .

What experimental protocols best evaluate CHRNA5's role in attention and working memory?

CHRNA5 plays a significant role in attention and cognitive processes, particularly through its expression in layer VI pyramidal neurons of the prefrontal cortex. These methodological approaches are recommended:

In vivo cognitive assessment protocols:

  • Five-choice serial reaction task: This validated protocol requires animals to encode and recall the location of a light stimulus among 5 possible positions

  • Working memory tasks: T-maze alternation or radial arm maze to assess memory manipulation

  • Electrophysiological recordings from prefrontal cortex layer VI pyramidal neurons to measure acetylcholine responsiveness

Human studies considerations:

  • Due to technical limitations of invasive procedures in humans, researchers should consider:

    • Microdialysis during attention task performance to measure acetylcholine efflux

    • Neuroimaging combined with genetic analysis

    • Pharmacological manipulation studies combined with cognitive testing

How can researchers distinguish between direct CHRNA5 effects and compensatory mechanisms in knockout models?

When working with CHRNA5 knockout models, compensatory mechanisms often confound interpretation. For example, deletion of alpha5 subunits in mice results in upregulation of muscarinic acetylcholine receptors as an excitatory compensation response .

Recommended methodological approaches:

  • Compare acute pharmacological inhibition with genetic knockout to differentiate immediate from compensatory effects

  • Use conditional and inducible knockout systems to control the timing of CHRNA5 deletion

  • Measure expression levels of other nicotinic and muscarinic receptors to identify compensation

  • Employ tissue-specific or cell-type-specific knockouts to isolate regional effects

What methodological approaches best identify genetic modifiers of CHRNA5-dependent nicotine consumption?

Researchers have developed sophisticated approaches to identify genetic modifiers that alter CHRNA5-mediated nicotine consumption behaviors:

Chromosome Substitution Strain (CSS) methodology:

  • Introgress the CHRNA5 knockout allele onto CSS panel (e.g., C57BL/6J-Chr# A/J/NaJ)

  • Test both wildtype and CHRNA5 KO littermates from each CSS

  • Identify chromosomes that modify the effect of CHRNA5 deletion on nicotine consumption

  • Use SNP screening to verify non-recombinant chromosomes

Key findings using this methodology:

  • Sex-independent modifiers were detected on chromosomes 5 and 11

  • A male-specific modifier was found on chromosome 15

  • Chromosomes 1 and 17 affected nicotine consumption independent of CHRNA5 genotype

ChromosomeEffect on Nicotine Consumption in CHRNA5 KOSex Specificity
5Reduced consumption relative to B6 CHRNA5 KOSex-independent
11Reduced consumption relative to B6 CHRNA5 KOSex-independent
15Reduced consumption relative to B6 CHRNA5 KOMale-specific
1Reduced consumption in both KO and wildtypeSex-independent
17Increased consumption in both KO and wildtypeSex-independent

How should researchers design experiments to study CHRNA5's role in multiple addiction types?

CHRNA5 mediates effects of various addictive substances beyond nicotine, including alcohol and cocaine . Comprehensive addiction research should implement these methodological approaches:

  • Cross-substance comparison studies:

    • Test the same CHRNA5 KO and wildtype cohorts with multiple substances

    • Use standardized self-administration protocols

    • Control for order effects with counterbalanced designs

  • Circuit-specific approaches:

    • Target the medial habenula, which is critical for CHRNA5's role in nicotine self-administration

    • Use optogenetics or chemogenetics to manipulate specific neural pathways

    • Combine with in vivo electrophysiology to measure circuit dynamics

  • Stress-dependent protocols:

    • Include stress conditions when studying alcohol intake, as CHRNA5 deletion affects alcohol consumption under stress

    • Implement validated stress paradigms (restraint, social defeat, etc.)

    • Measure stress hormones to correlate with behavioral changes

What are the optimal methods for expressing and purifying recombinant human CHRNA5 for structural studies?

Based on established protocols for nicotinic receptor subunits, researchers should consider these methodological approaches:

  • Expression systems:

    • Mammalian expression systems (HEK293, CHO cells) maintain proper post-translational modifications

    • Insect cell (Sf9, Hi5) baculovirus systems offer higher yields

    • Stable cell lines expressing CHRNA5 with other subunits (CHRNA3, CHRNB4) to form functional pentamers

  • Purification strategies:

    • Affinity tags (His, FLAG, or Strep) with careful placement to avoid functional interference

    • Detergent solubilization optimization for membrane protein extraction

    • Size exclusion chromatography for isolation of properly assembled receptors

  • Structural analysis approaches:

    • Cryo-electron microscopy for near-atomic resolution structures

    • X-ray crystallography requiring stabilized constructs

    • Hydrogen-deuterium exchange mass spectrometry for conformational dynamics

How can CHRNA5 research findings best translate to therapeutic development for addiction and cognitive disorders?

Translating CHRNA5 research into therapeutics requires careful methodological consideration:

Pharmacological targeting approaches:

  • Develop ligands with specificity for α5-containing receptors, considering the current known ligands:

LigandStructureFunctionPotential Clinical Application
PozaniclinePartial agonistADHD, Alzheimer's disease, tobacco use disorder
α-Conotoxin MIIAntagonistResearch tool for receptor characterization
α-Conotoxin PnIAAntagonistResearch tool for receptor characterization
α-Conotoxin GICAntagonistResearch tool for receptor characterization
α-Conotoxin TXIAAntagonistResearch tool for receptor characterization
  • Target specific brain regions where CHRNA5 function is critical:

    • Layer VI pyramidal neurons in prefrontal cortex for cognitive enhancement

    • Medial habenula for addiction treatment

    • Consider region-specific delivery methods

  • Account for genetic variation in CHRNA5:

    • Develop pharmacogenetic approaches considering functional polymorphisms

    • Design clinical trials stratified by CHRNA5 genotype

    • Implement precision medicine approaches based on individual genetic profiles

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.