Recombinant Human Neuronal acetylcholine receptor subunit beta-2 (CHRNB2)

Shipped with Ice Packs
In Stock

Description

Protein Structure

CHRNB2 is a transmembrane protein composed of multiple domains, including extracellular, transmembrane, and intracellular regions. Recombinant versions typically span amino acids 26–130 or 26–233, excluding signal peptides and intracellular domains . The protein belongs to the ligand-gated ion channel (LGIC) family and forms heteropentameric complexes with alpha subunits (e.g., α4) to create functional nAChRs .

Functional Role

Upon acetylcholine or nicotine binding, CHRNB2-containing receptors undergo conformational changes, opening ion-conducting channels permeable to Na⁺, K⁺, and Ca²⁺ ions . These channels regulate neuronal excitability, synaptic release of neurotransmitters, and processes like attention, memory, and pain perception .

Production and Expression Details

Recombinant CHRNB2 is produced via heterologous expression systems, with key parameters summarized below:

ParameterWheat Germ System E. coli System
Expression Region26–130 aa26–233 aa
TagNoneN-terminal 10XHis-V5
Theoretical MWNot specified31.9 kDa
PuritySuitable for ELISA/WB>85% (SDS-PAGE)
Storage-80°C (Dry Ice)-20°C (Lyophilized)

Key Observations:

  • Wheat germ systems produce smaller fragments (26–130 aa) for antibody-based assays .

  • E. coli systems yield longer constructs (26–233 aa) with N-terminal tags for purification .

  • Observed molecular weights in Western blot (WB) often differ from theoretical values due to post-translational modifications or proteolytic cleavage (e.g., 46 kDa and 52 kDa bands) .

Research Applications and Experimental Uses

Recombinant CHRNB2 is employed in diverse experimental contexts:

Antibody-Based Assays

  • Western Blot (WB): Detects CHRNB2 in human cell lysates (e.g., HeLa, Jurkat) using polyclonal antibodies, though observed band sizes (46 kDa, 52 kDa) may reflect truncated isoforms .

  • Immunocytochemistry (ICC/IF): Visualizes subcellular localization of nAChR complexes in neuronal tissues .

Functional Studies

  • Ion Channel Activity: Recombinant CHRNB2 is used to study receptor gating kinetics and ligand specificity (e.g., nicotine vs. acetylcholine) .

  • Epigenetic and Genetic Research: Examines mutations linked to autosomal dominant nocturnal frontal lobe epilepsy (ADNFLE), which enhance acetylcholine sensitivity .

Autosomal Dominant Nocturnal Frontal Lobe Epilepsy (ADNFLE)

Missense mutations in CHRNB2 (e.g., V287L, I312M) disrupt receptor function, causing hypersensitivity to acetylcholine and aberrant neuronal excitation . This leads to nocturnal seizures originating in frontal lobes.

Substance Abuse and Cognitive Disorders

Polymorphisms in CHRNB2 (e.g., rs2072658) correlate with altered subjective responses to alcohol and nicotine, suggesting a role in addiction vulnerability .

Comparative Analysis of Recombinant CHRNB2 Variants

FeatureAbcam (Wheat Germ) Cusabio (E. coli) Biomatik (E. coli)
Expression SystemWheat germE. coliE. coli
Expression Region26–130 aa26–233 aa26–233 aa
TagNoneNoneN-terminal 10XHis-V5
PurityNot specified>85% (SDS-PAGE)>85% (SDS-PAGE)
ApplicationsELISA, WBELISA, WBELISA, WB

Notable Differences:

  • Tag Presence: Biomatik’s variant includes purification tags for enhanced yield .

  • Fragment Length: E. coli systems produce longer constructs, capturing more functional domains .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please specify it when placing your order, and we will fulfill your request.
Lead Time
Delivery time may vary based on the purchasing method or location. Please contact your local distributor for specific delivery timelines.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial prior to opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by multiple factors including storage conditions, buffer ingredients, temperature, and the protein's intrinsic stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing it accordingly.
Synonyms
CHRNB2; Neuronal acetylcholine receptor subunit beta-2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
26-502
Protein Length
Full Length of Mature Protein
Species
Homo sapiens (Human)
Target Names
CHRNB2
Target Protein Sequence
TDTEERLVEHLLDPSRYNKLIRPATNGSELVTVQLMVSLAQLISVHEREQIMTTNVWLTQ EWEDYRLTWKPEEFDNMKKVRLPSKHIWLPDVVLYNNADGMYEVSFYSNAVVSYDGSIFW LPPAIYKSACKIEVKHFPFDQQNCTMKFRSWTYDRTEIDLVLKSEVASLDDFTPSGEWDI VALPGRRNENPDDSTYVDITYDFIIRRKPLFYTINLIIPCVLITSLAILVFYLPSDCGEK MTLCISVLLALTVFLLLISKIVPPTSLDVPLVGKYLMFTMVLVTFSIVTSVCVLNVHHRS PTTHTMAPWVKVVFLEKLPALLFMQQPRHHCARQRLRLRRRQREREGAGALFFREAPGAD SCTCFVNRASVQGLAGAFGAEPAPVAGPGRSGEPCGCGLREAVDGVRFIADHMRSEDDDQ SVSEDWKYVAMVIDRLFLWIFVFVCVFGTIGMFLQPLFQNYTTTTFLHSDHSAPSSK
Uniprot No.

Target Background

Function
Upon binding acetylcholine, the AChR undergoes a significant conformational change that affects all subunits. This change results in the opening of an ion-conducting channel across the plasma membrane, allowing the passage of sodium ions.
Gene References Into Functions
  1. MAFA regulates insulin secretion mediated by the autonomic nervous system by activating the transcription of nicotinic (ChrnB2 and ChrnB4) receptor genes. This function is impaired in patients with type 2 diabetes. PMID: 26904947
  2. Data demonstrates efficient expression of (alpha6beta2)2beta3 nicotinic acetylcholine receptors (AChRs) in Xenopus oocytes using free subunits, with only minimal changes in alpha6 subunits. This expression does not alter AChR pharmacology or channel structure. PMID: 25068303
  3. This study suggests that rs2072660 has a significant impact on nicotine dependence. There was no direct association observed between depressive phenotype (including ZSDS total scores and subscales) and CHRNB2 variants. PMID: 25640319
  4. Following smoking reduction and cessation, alpha4beta2* nAChR densities decreased across various brain regions. PMID: 23429692
  5. Evidence suggests a significant association between common sequence variations in CHRNB2 and nausea severity after adjusting for age, gender, and correlated tests in patients utilizing varenicline for smoking cessation. PMID: 21606948
  6. A novel mutant mouse model incorporating the human ADNFLE mutation in the Chrnb2 gene was created and used to study the roles of beta2* nicotinic receptors in complex biological processes including the activity-rest cycle, natural reward, and anxiety. PMID: 20603624
  7. Variations in the promoter region of the CHRNB2 gene may play a crucial role in mediating expression levels of the beta2 nicotinic receptor subunit, potentially influencing individual differences in subjective responses to nicotine. PMID: 20854418
  8. Mutations in the CHRNB2 and CHRNA2 genes may be rare in Chinese autosomal dominant nocturnal frontal lobe epilepsy (ADNFLE). PMID: 21287502
  9. Concatameric pentamers and pentamers formed from combinations of trimers, dimers, and monomers of alpha6beta2beta3* acetylcholine receptors exhibit similar properties, indicating that the linkers between subunits do not alter their functional characteristics. PMID: 20923852
  10. The high sensitivity to activation and desensitization of (alpha4beta2)alpha5 nAChRbeta2 by nicotine results in a narrow concentration range where activation and desensitization curves overlap. PMID: 20881005
  11. Using high-resolution NMR spectroscopy, the structure of the entire transmembrane domain (TM1234) of the beta2 subunit was determined. The study revealed that TM1234 formed a four-helix bundle in the absence of the extracellular and intracellular domains. PMID: 20441771
  12. Data suggests that beta(2)*-nAChRs play a role in pain sensitivity, but not pain tolerance, during tobacco smoking withdrawal. PMID: 20371741
  13. There was no evidence of association between any SNPs in CHRNAB2 (rs2072661, rs4845378) or CHRNAB3 (rs4953, rs6474413) and smoking status (p=0.30). Additionally, no association was found between these SNPs and cotinine levels in daily smokers (p=0.08). PMID: 19482438
  14. An association was observed between a 3' untranslated region polymorphism (rs2072661) in the nicotinic acetylcholine receptor beta2 subunit (CHRNB2) gene and quitting success in response to nicotine versus placebo patch during a short-term test of patch effects. PMID: 19755656
  15. CHRNB2 is a logical candidate gene for influencing smoking behavior and nicotine dependence. PMID: 11906688
  16. Autosomal dominant nocturnal frontal lobe epilepsy probands were analyzed for the presence of V287L and V287M mutations in the CHRNB2 gene. No mutations were found in the analyzed region of CHRNB2. PMID: 11952766
  17. Mutations in the gene encoding CHRNB2 may be linked to nocturnal frontal lobe epilepsy. PMID: 12185808
  18. The CHRNB2 subunit is expressed in the soma of the majority of pyramidal cells, with the highest beta 2 immunoreactivity observed in CA2-4 and entorhinal cortex, and relatively lower levels in CA1 and subicular pyramidal cell soma. PMID: 12663058
  19. Mutations in genes coding for the alpha 4 and beta 2 subunits of the neuronal nicotinic acetylcholine receptor receptor (CHRN) are known to cause autosomal dominant nocturnal frontal lobe epilepsy (ADNFLE). PMID: 12681012
  20. A significant association for Alzheimer's disease was observed for a non-coding polymorphism in the CHRNB2 subunit. PMID: 15026168
  21. Nicotinic acetylcholine receptor beta 2 subunit polymorphisms were found not to be a useful marker for predicting susceptibility to febrile seizures. PMID: 15033200
  22. A new CHRNB2 mutation located in transmembrane region 3 (M3), outside the known ADNFLE mutation cluster, is reported. The CHRNB2 mutation I312M, occurring de novo in twins, significantly increases the receptor's sensitivity to acetylcholine. PMID: 15964197
  23. Higher beta2*-nAChR availability during early abstinence may influence the ability of smokers to maintain abstinence. PMID: 16928859
  24. This study provides the first evidence for an association between the CHRNB2 gene and nicotine- and alcohol-related phenotypes. It suggests that polymorphisms in CHRNB2 may play a significant role in mediating early responses to nicotine and alcohol. PMID: 17226798
  25. This is the third reported family presenting a mutation in CHRNB2 associated with nocturnal frontal lobe epilepsy. PMID: 17900292
  26. These findings in living human subjects corroborate postmortem reports of decline in high-affinity nicotine binding with age and may contribute to understanding the role of beta(2)-nAChRs in cognitive aging. PMID: 18242781
  27. Genetic testing revealed the CHRNB2 mutation I312M in transmembrane region 3 (M3) of the neuronal nicotinic acetylcholine receptor. PMID: 18534914
  28. An SNP (rs2072661) in the 3' UTR region of the CHRNB2 gene has an impact on abstinence rates at the end of treatment and after a 6-month follow-up period. PMID: 18593715

Show More

Hide All

Database Links

HGNC: 1962

OMIM: 118507

KEGG: hsa:1141

STRING: 9606.ENSP00000357461

UniGene: Hs.2306

Involvement In Disease
Epilepsy, nocturnal frontal lobe, 3 (ENFL3)
Protein Families
Ligand-gated ion channel (TC 1.A.9) family, Acetylcholine receptor (TC 1.A.9.1) subfamily, Beta-2/CHRNB2 sub-subfamily
Subcellular Location
Cell junction, synapse, postsynaptic cell membrane; Multi-pass membrane protein. Cell membrane; Multi-pass membrane protein.

Q&A

What is CHRNB2 and what is its primary function in human biology?

CHRNB2 encodes the β2 subunit of the nicotinic acetylcholine receptor (nAChR), particularly the α4β2 subtype. This protein belongs to the ligand-gated ion channel family within the acetylcholine receptor subfamily . After binding acetylcholine, the receptor undergoes extensive conformational changes affecting all subunits, which leads to the opening of an ion-conducting channel across the plasma membrane that is permeable to sodium ions . This channel function is crucial for neurotransmission in the central nervous system, particularly for processes related to cognitive function and addiction pathways .

How does CHRNB2 interact with other receptor subunits in functional neuronal signaling?

CHRNB2 primarily interacts with the CHRNA4 subunit (α4) to form α4β2 nicotinic acetylcholine receptors in the central nervous system . This interaction is critical as human nAChR β2 subunits combine with α4 subunits to generate specific forms of α4-nAChR with distinctive physiological properties . The stoichiometry and arrangement of these subunits determine the receptor's pharmacological properties, including sensitivity to agonists and antagonists. When properly assembled, these receptors respond to acetylcholine binding with conformational changes that open the ion channel, allowing sodium influx and triggering downstream signaling cascades essential for neuronal communication .

What genetic variations in CHRNB2 have been identified and what are their physiological implications?

Research has identified several significant genetic variations in CHRNB2 with important physiological implications:

  • Rare predicted loss-of-function and likely deleterious missense variants in CHRNB2 are associated with a 35% decreased odds for smoking heavily (OR = 0.65, CI = 0.56–0.76, P = 1.9 × 10^-8)

  • An independent common variant (rs2072659) shows association in the protective direction against smoking (OR = 0.96; CI = 0.94–0.98; P = 5.3 × 10^-6)

  • Mutations in CHRNB2 have been linked to autosomal dominant nocturnal frontal lobe epilepsy

  • Polymorphisms in CHRNB2 may influence initial subjective responses to both nicotine and alcohol, suggesting a role in early substance response mechanisms

These variations highlight the critical role of CHRNB2 in addiction pathways, neurological disorders, and individual differences in drug responses.

What experimental models are most appropriate for studying CHRNB2 function in neuronal signaling?

Several experimental models have proven valuable for studying CHRNB2 function:

  • Knockout mouse models: CHRNB2 knockout mice (β2(-/-)) have been instrumental in understanding this receptor's role in nicotine response. These models show that nicotine fails to elicit striatal dopamine release, fails to increase discharge frequency of midbrain dopaminergic neurons at concentrations similar to those in human smokers, and fails to elicit self-administration behaviors .

  • Retinal development models: Mice lacking CHRNB2 expression display abnormal retinal waves and dispersed projection of retinal ganglion cell axons to their dorsal lateral geniculate nuclei, making them valuable for studying neurodevelopmental processes .

  • Cell culture systems: Human cell lines expressing recombinant CHRNB2, particularly when co-expressed with CHRNA4, provide controlled systems for studying receptor assembly, trafficking, and electrophysiological properties .

  • Genetic association studies in human populations: Large-scale human studies (as seen in the exome-wide association study with 749,459 individuals) can reveal relationships between CHRNB2 variants and behavioral phenotypes like smoking .

The choice of model should align with the specific research question, considering whether you're investigating protein structure, function, genetic associations, or therapeutic potential.

What are the methodological considerations when working with recombinant CHRNB2 in experimental settings?

When working with recombinant CHRNB2 in experimental settings, researchers should consider the following methodological factors:

Expression Systems:

  • Wheat germ expression systems have been successfully used to produce recombinant human CHRNB2 protein fragments (aa 26-130 range) suitable for ELISA and Western blot applications

  • Mammalian expression systems may be preferred for studies requiring properly folded and post-translationally modified full-length protein

Protein Characterization:

  • Western blot analysis using specific antibodies can confirm expression and size (predicted band size of 57 kDa; observed band size often around 48 kDa in human cerebellum lysate)

  • Immunohistochemistry with antibodies like ab189174 at concentrations of 3.75 μg/ml can visualize CHRNB2 in tissues such as human brain cortex

Functional Studies:

  • Electrophysiological assays (patch-clamp) should be considered for evaluating channel function

  • Co-expression with relevant alpha subunits (especially CHRNA4) is essential for proper receptor assembly and function

  • Radioligand binding assays with appropriate ligands can assess receptor pharmacology

Quality Control:

  • Verification of protein integrity and purity through SDS-PAGE and mass spectrometry

  • Confirmation of proper folding through circular dichroism or other structural analyses

  • Validation of functional activity through ligand binding or electrophysiological studies

How can CHRNB2 variants be leveraged for drug discovery targeting nicotine addiction?

The discovery of CHRNB2 variants associated with reduced smoking propensity provides a unique opportunity for drug discovery targeting nicotine addiction . Methodological approaches include:

  • Structure-based drug design: Using the structural insights from naturally occurring protective variants in CHRNB2, researchers can design compounds that mimic the functional effects of these variants. This approach has proven successful in other therapeutic areas .

  • High-throughput screening: Developing cell-based assays expressing wild-type or variant CHRNB2 (with CHRNA4) to screen chemical libraries for compounds that modulate receptor function in ways similar to the protective variants.

  • Allosteric modulator development: Since complete antagonism might have unwanted side effects, researchers should consider developing positive or negative allosteric modulators that fine-tune receptor function rather than completely blocking it.

  • Brain-specific targeting strategies: Given that β2 loss abolishes nicotine-mediated neuronal responses and attenuates nicotine self-administration in mice, developing brain-specific CHRNB2 modulators could potentially reduce addiction while minimizing peripheral effects .

  • Personalized medicine approaches: Genetic screening for CHRNB2 variants could identify individuals who might respond best to specific smoking cessation therapies.

The alignment between human genetic findings (35% decreased odds for smoking heavily in carriers of certain CHRNB2 variants) and decades-old experimental observations in mice provides strong translational validity for this target .

What role does CHRNB2 play in neuroinflammatory processes and neurodegenerative disorders?

Emerging research suggests CHRNB2 may have significant roles in neuroinflammatory processes and neurodegenerative conditions:

Inflammatory Pathway Involvement:

  • Studies indicate that Chrnb2 may be involved in inflammation responses by regulating key pro-inflammatory cytokines including TNF-α, IL-1β, and IL-6

  • In dry eye disease (DED) models, knockdown of Chrnb2 with siRNA significantly downregulated these inflammatory cytokines in human corneal epithelial cells

Neurodegenerative Connections:

  • Recent studies have found various α4β2-nAChR variants in individuals with conditions such as Alzheimer's disease (AD), attention-deficit hyperactivity disorder (ADHD), amyotrophic lateral sclerosis (ALS), Parkinson's disease (PD), and other brain abnormalities

  • Research indicates that nAChRs, including those containing CHRNB2, may play a significant role in neurodegenerative disorders by affecting neuronal function through regulatory pathways that are still being discovered

  • Understanding how nAChRs interact with disease-related aggregates (such as β-amyloid in Alzheimer's disease) could lead to new treatment approaches

Methodological Investigation Approaches:

  • Co-immunoprecipitation studies to detect interactions between CHRNB2-containing receptors and disease-related proteins

  • Transgenic animal models expressing human CHRNB2 variants found in neurodegenerative conditions

  • Electrophysiological studies examining how disease-related proteins modify α4β2 receptor function

  • Calcium imaging to assess how CHRNB2-containing receptors influence neuronal calcium homeostasis in disease states

What are the optimal approaches for detecting and quantifying CHRNB2 expression in tissue samples?

Detecting and quantifying CHRNB2 expression in tissue samples requires careful consideration of several methodological approaches:

Protein Detection Methods:

  • Western Blotting:

    • Effective using antibodies like goat polyclonal anti-CHRNB2 (ab189174) at 1 μg/mL

    • Human cerebellum lysate in RIPA buffer (35 μg) shows predicted band size of 57 kDa with observed band at 48 kDa

  • Immunohistochemistry:

    • Formalin-fixed, paraffin-embedded human brain cortex tissue can be labeled using anti-CHRNB2 antibodies at 3.75 μg/ml

    • This approach allows visualization of receptor distribution in tissue context

  • ELISA:

    • Recombinant CHRNB2 protein fragments expressed in wheat germ can be used as standards

    • Suitable for quantitative analysis in tissue homogenates

mRNA Expression Analysis:

  • RT-qPCR:

    • Validated for detecting CHRNB2 mRNA expression changes in experimental models

    • Successfully implemented in studies of dry eye disease models showing significant upregulation

  • RNA-Seq:

    • Allows comprehensive analysis of expression patterns alongside other genes

    • Capable of detecting novel splice variants that may have functional significance

Sample Preparation Considerations:

  • Brain tissues require careful handling to preserve membrane protein integrity

  • For Western blotting, RIPA buffer has been successfully used for extraction

  • For immunohistochemistry, formalin fixation and paraffin embedding preserve tissue architecture while allowing antibody access

What experimental design factors should be considered when studying CHRNB2 in relation to nicotine addiction and response?

When designing experiments to study CHRNB2 in nicotine addiction and response, researchers should consider several critical factors:

Genetic Analysis Approaches:

  • Population Selection:

    • Large sample sizes are crucial (the key study used 749,459 individuals)

    • Consider diverse ethnic backgrounds to account for population-specific variants

    • Include appropriate controls matched for age, sex, and environmental factors

  • Variant Classification:

    • Distinguish between loss-of-function, missense, and common variants

    • The different variant types may have distinct effects (e.g., rare loss-of-function vs. common variants)

Phenotype Characterization:

  • Smoking Behavior Metrics:

    • Define clear phenotypes (e.g., heavy smoking, nicotine dependence scores, quit success)

    • Consider longitudinal assessment of smoking behaviors

    • Include measures of initial subjective responses to nicotine

  • Comorbidity Assessment:

    • Evaluate alcohol use behaviors due to shared genetic influences

    • Screen for neurological conditions associated with CHRNB2 variants

Functional Validation Studies:

  • In vitro Models:

    • Use cell lines expressing wild-type vs. variant CHRNB2

    • Co-express with CHRNA4 to form functional receptors

    • Employ electrophysiological techniques to measure channel function

  • Animal Models:

    • Consider CHRNB2 knockout models to study complete loss of function

    • Use knockin models with specific human variants to study their effects

    • Assess behaviors relevant to addiction (self-administration, withdrawal)

Translational Approaches:

  • Pharmacological Validation:

    • Test effects of nicotinic receptor compounds in models expressing variants

    • Assess whether existing smoking cessation medications have differential effects based on CHRNB2 genotype

  • Biomarker Development:

    • Evaluate whether CHRNB2 variants can predict treatment response

    • Develop assays to measure receptor function in accessible tissues

What emerging technologies could advance our understanding of CHRNB2 function in complex neuronal networks?

Several cutting-edge technologies hold promise for advancing our understanding of CHRNB2 function in complex neuronal networks:

Advanced Imaging Approaches:

  • Cryo-electron microscopy: Could provide high-resolution structural information about CHRNB2-containing receptors in different conformational states, enhancing our understanding of how variants affect receptor function

  • Optogenetic tools: Development of light-sensitive CHRNB2-containing channels would allow precise temporal control of receptor activation in specific neuronal populations

  • Genetically encoded calcium indicators: When combined with CHRNB2 expression systems, these can reveal how receptor activation influences calcium dynamics in real-time within neuronal networks

Genetic Engineering Technologies:

  • CRISPR-Cas9 gene editing: Enables precise introduction of CHRNB2 variants identified in human populations into cellular or animal models for functional characterization

  • Single-cell transcriptomics: Allows mapping of CHRNB2 expression patterns at unprecedented cellular resolution across brain regions and in disease states

  • AAV-based gene therapy approaches: Could be used to modulate CHRNB2 expression in specific brain regions to evaluate therapeutic potential in addiction or neurological disorders

Computational and Systems Biology Approaches:

  • Molecular dynamics simulations: Can predict how specific amino acid changes affect receptor structure and function, guiding drug design efforts

  • Network pharmacology: Integrates CHRNB2 function into broader signaling networks to identify novel therapeutic targets and potential side effects

  • AI-driven drug discovery: Machine learning approaches can accelerate the identification of compounds that modulate CHRNB2-containing receptors in desired ways

How might understanding CHRNB2 variants inform personalized approaches to treating nicotine addiction and related disorders?

Understanding CHRNB2 variants could transform personalized approaches to treating nicotine addiction and related disorders through several pathways:

Genetic Testing and Risk Assessment:

  • Screening for protective variants like those associated with 35% decreased odds of heavy smoking could identify individuals at lower genetic risk for nicotine addiction

  • Testing for CHRNB2 variants associated with subjective responses to nicotine and alcohol could help predict comorbid addiction risks

Pharmacogenomic Applications:

  • CHRNB2 variant profiles could predict individual responses to existing smoking cessation medications

  • Data suggests an allelic series in CHRNB2, with different variants having varying effects on smoking behavior

  • This genetic information could guide personalized dosing strategies or medication selection

Novel Therapeutic Approaches:

  • Drug designs targeting CHRNB2 inspired by naturally occurring protective variants represent a promising direction

  • Different approaches might be optimal for different genetic profiles:

    • Partial agonists for some variant carriers

    • Negative allosteric modulators for others

    • Combination therapies targeting multiple receptor subtypes

Intervention Timing and Type:

  • Knowledge of how CHRNB2 variants affect initial subjective responses to nicotine could inform early intervention strategies

  • Individuals with variants affecting particular signaling pathways might benefit from targeted behavioral interventions alongside pharmacotherapy

Broader Neuropsychiatric Applications:

  • Since CHRNB2 has been implicated in conditions beyond addiction (epilepsy, neurodevelopmental disorders), variant analysis could inform treatment approaches for these comorbid conditions

  • Understanding the role of CHRNB2 in neuroinflammatory processes could open new treatment avenues for conditions where inflammation contributes to pathology

Methodological Approach for Implementation:

  • Development of clinical genetic testing panels including key CHRNB2 variants

  • Creation of algorithms integrating genetic, clinical, and environmental factors to guide treatment selection

  • Clinical trials stratifying participants by CHRNB2 genotype to evaluate treatment response differences

  • Long-term outcome studies correlating genetic profiles with sustained abstinence rates

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.