Recombinant Human Neuronal membrane glycoprotein M6-b (GPM6B)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for fulfillment.
Lead Time
Delivery times vary by purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to pellet the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50% and may serve as a guideline for your preparations.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If a specific tag type is required, please inform us; we will prioritize its use.
Synonyms
GPM6B; M6B; Neuronal membrane glycoprotein M6-b; M6b
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-265
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
GPM6B
Target Protein Sequence
MKPAMETAAEENTEQSQERKGCFECCIKCLGGVPYASLVATILCFSGVALFCGCGHVALA GTVAILEQHFSTNASDHALLSEVIQLMQYVIYGIASFFFLYGIILLAEGFYTTSAVKELH GEFKTTACGRCISGMFVFLTYVLGVAWLGVFGFSAVPVFMFYNIWSTCEVIKSPQTNGTT GVEQICVDIRQYGIIPWNAFPGKICGSALENICNTNEFYMSYHLFIVACAGAGATVIALL IYMMATTYNYAVLKFKSREDCCTKF
Uniprot No.

Target Background

Function
Recombinant Human Neuronal membrane glycoprotein M6-b (GPM6B) may be involved in neural development, osteoblast function and bone formation regulation, and matrix vesicle release by osteoblasts (potentially via actin cytoskeleton maintenance). It may also play a role in cellular trafficking of the serotonin transporter (SERT) and thus serotonin uptake regulation.
Gene References Into Functions
  1. Elevated GPM6B mRNA and protein expression is associated with various gynecological malignancies. PMID: 25113253
  2. Circulating DR6 and GPM6B levels correlate with breast cancer tumor grade. PMID: 24696529
  3. High-resolution melting analysis of GPM6B, MAGE-A12, and Fc receptor promoters reveals differences that indicate hepatocellular carcinoma invasiveness. PMID: 23950870
  4. Microarray analysis of GPM6B-depleted osteogenic human mesenchymal stem cells shows significant changes in genes related to cytoskeleton organization and biogenesis. PMID: 21638316
  5. Studies suggest that M6B mutations are unlikely to be involved in Pelizaeus-Merzbacher-like syndrome. PMID: 15214007
  6. M6B appears to regulate serotonin uptake by influencing SERT cellular trafficking. PMID: 18581270
Database Links

HGNC: 4461

OMIM: 300051

KEGG: hsa:2824

UniGene: Hs.495710

Protein Families
Myelin proteolipid protein family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Neurons and glia; cerebellar Bergmann glia, in glia within white matter tracts of the cerebellum and cerebrum, and in embryonic dorsal root ganglia.

Q&A

What is the cellular distribution of GPM6B in the nervous system?

GPM6B is ubiquitously expressed throughout the brain, with highest abundance in neurons, oligodendrocytes, and a subset of astrocytes . Unlike GPM6A which is exclusively neuronal, GPM6B expression extends to glial cells . This differential expression pattern suggests distinct functional roles for these proteins in neural tissue. For comprehensive characterization in experimental systems, immunohistochemistry using cell-type specific markers (NeuN for neurons, GFAP for astrocytes, and Olig2 for oligodendrocytes) alongside GPM6B antibodies can provide quantitative distribution data across brain regions.

What are the key structural domains of GPM6B protein?

GPM6B contains critical transmembrane domains and coiled-coil structural motifs encoded by exon 3 (out of 11 total exons) . These domains are particularly important for cellular interaction and membrane trafficking functions. When designing recombinant constructs, preservation of these domains is essential for maintaining native functionality. Structural analysis using hydropathy plots and transmembrane prediction algorithms can guide the design of functional recombinant GPM6B proteins for experimental applications.

How does GPM6B relate to other proteolipid proteins?

GPM6B shows high structural homology to myelin proteolipid protein (PLP) . This evolutionary relationship suggests that GPM6B and other membrane proteins in this family likely evolved from a primitive gene encoding a membrane pore-forming protein . When conducting comparative studies, alignment analyses between GPM6B and PLP sequences can reveal conserved functional domains versus unique regions that may account for their differential cellular functions.

What are the primary cellular functions associated with GPM6B?

GPM6B participates in several critical cellular processes including:

  • Membrane trafficking and cell-to-cell communication

  • Axon growth and guidance

  • Stress response mechanisms

  • Regulation of serotonin transporter surface expression

  • TGF-β-Smad2/3 signaling pathway activation

Experimental designs investigating these functions should incorporate appropriate cellular assays for each pathway, including membrane protein trafficking assays, axon growth measurements, and signaling pathway activation markers.

What methodologies are most effective for studying GPM6B expression modulation in neuropsychiatric models?

Based on current research approaches, CRISPR/Cas9 gene editing has proven effective for creating GPM6B knockout models . The methodology involves:

  • Design of sgRNA targeting critical exons (e.g., exon 3) containing coding regions for transmembrane domains

  • Microinjection of CRISPR mix using sgRNA and Cas9 mRNA

  • Verification of deletions via Sanger sequencing

  • Backcrossing founders to wildtype background (e.g., C57BL/6J) to minimize off-target effects

  • Generation of heterozygous and homozygous lines through appropriate breeding schemes

  • Confirmation of knockout efficiency through qRT-PCR

For overexpression studies, viral vectors (particularly AAV) have shown efficacy in delivering GPM6B to target tissues . RNA sequencing following expression manipulation can identify downstream transcriptional changes, with particular attention to pathways involving Wnt signaling, stem cell differentiation, and TGF-β signaling .

How should researchers interpret conflicting behavioral phenotypes in GPM6B mutant models?

GPM6B deletion produces seemingly contradictory effects: deficits in delay discounting tasks while simultaneously enhancing reward sensitivity and behavioral flexibility in probabilistic reversal learning tasks . This apparent contradiction highlights the complexity of GPM6B's role in decision-making circuits.

When designing behavioral experiments:

  • Include multiple behavioral paradigms measuring different aspects of decision-making

  • Control for confounding variables such as anxiety-like behaviors (using elevated plus maze and light-dark box tests)

  • Consider sex differences, as GPM6B is located on the X chromosome

  • Employ parallel molecular analyses (e.g., serotonergic signaling markers) alongside behavioral testing

  • Use standardized protocols for behavioral assays to enable cross-laboratory comparisons

The opposing effects observed suggest GPM6B may differentially modulate distinct neural circuits governing impulsivity versus cognitive flexibility.

What transcriptional changes occur following GPM6B manipulation, and how can they inform experimental design?

RNA sequencing analyses following GPM6B overexpression reveal significant transcriptional changes, with differential expression of genes involved in:

  • Wnt signaling pathway

  • Stem cell differentiation

  • Inner ear development

  • Cell cycle regulation (Cdc20, Gadd45a, Pmp22, Stmn1)

  • Transcription factors (Pou3f1, Foxd3)

  • EGF signaling pathway (Fn1, Col1a1)

  • TGF-β signaling pathway (Id2)

For robust experimental designs investigating these pathways:

  • Include time-course analyses to capture early, intermediate, and late transcriptional changes

  • Validate key findings with qPCR and protein-level analyses

  • Use pathway inhibitors to confirm causality in observed phenotypes

  • Consider cell-type specific approaches to determine where critical transcriptional changes occur

What methodological approaches best characterize GPM6B's role in serotonergic signaling?

GPM6B reduces serotonin transporter (SERT) activity by downregulating transporter surface expression . For comprehensive investigation:

  • Employ surface biotinylation assays to quantify SERT membrane expression

  • Measure serotonin uptake kinetics in GPM6B-manipulated systems

  • Use pharmacological challenges with serotonergic drugs (e.g., 5-HT2A/C agonists like DOI)

  • Perform electrophysiological recordings in relevant circuits

  • Consider conditional and temporally controlled gene manipulation approaches

Since GPM6B mutants show altered responses to serotonergic drugs and GPM6B is downregulated in suicide victims' brains , these approaches can yield insights into psychiatric disorders characterized by serotonergic dysfunction.

How can GPM6B's role in cellular differentiation be experimentally leveraged for regenerative applications?

GPM6B overexpression supports hair cell reprogramming in the cochlea through activation of multiple signaling pathways . For exploiting this regenerative potential:

  • Design AAV vectors with cell-type specific promoters for targeted GPM6B expression

  • Monitor TGF-β-Smad2/3 signaling activation, as GPM6B stimulates this pathway

  • Examine Wnt pathway activation markers alongside GPM6B expression

  • Track expression of key factors identified in RNA-seq analyses

  • Employ lineage tracing methods to confirm cellular fate transitions

Of particular importance is GPM6B's demonstrated role in protection against aminoglycoside-induced hair cell loss through TGF-β1 upregulation . This suggests potential therapeutic applications beyond mere replacement of damaged cells.

What expression systems are optimal for producing functional recombinant GPM6B?

When producing recombinant GPM6B:

  • Mammalian expression systems (particularly HEK293 or neuronal cell lines) better preserve post-translational modifications

  • Include C-terminal tags rather than N-terminal to avoid disrupting signal peptide function

  • Verify proper membrane localization using subcellular fractionation

  • Consider detergent micelles, proteoliposomes, or nanodiscs for maintaining protein stability

  • For structural studies, employ strategies that accommodate the transmembrane domains

The critical nature of GPM6B's membrane domains means that bacterial expression systems typically yield lower functionality compared to eukaryotic alternatives.

What are the most reliable approaches for detecting GPM6B protein expression in experimental systems?

For reliable GPM6B detection:

  • Use antibodies targeting conserved epitopes in the C-terminal domain

  • Implement multiple detection methods: western blotting, immunohistochemistry, and flow cytometry

  • Include appropriate positive and negative controls (e.g., GPM6B knockout tissue)

  • Employ qRT-PCR for transcript quantification alongside protein detection

  • Consider proximity ligation assays for detecting protein-protein interactions

When performing immunohistochemistry, optimize fixation protocols to preserve membrane epitopes, as overfixation can mask transmembrane protein detection.

How can GPM6B research inform the understanding of psychiatric disorders?

GPM6B has been implicated in several psychiatric phenotypes:

  • Reduced prepulse inhibition, relevant to schizophrenia

  • Altered response to serotonergic drugs

  • Significant downregulation in suicide victims' hippocampus and prefrontal cortex

  • Association with delay discounting and impulsive behaviors

Research approaches should include:

  • Cross-species validation of behavioral phenotypes

  • Analysis of human GPM6B variants identified in psychiatric populations

  • Integration with other genetic risk factors

  • Examination of GPM6B expression in response to psychiatric medications

  • Studies of interactions between environmental stressors and GPM6B function

What experimental designs best address sex differences in GPM6B research?

Because GPM6B is located on the X chromosome , sex differences are particularly important:

  • Include both male and female subjects in all studies, with appropriate sample sizes

  • Consider X-inactivation effects in females through specific molecular approaches

  • Examine potential hormonal interactions with GPM6B expression and function

  • Design breeding schemes that allow for the study of heterozygous females

  • Analyze potential sexually dimorphic phenotypes across multiple systems

Most published research has focused primarily on male subjects due to the X-chromosome location of GPM6B , leaving significant knowledge gaps regarding sex-specific effects.

How might single-cell approaches advance understanding of GPM6B function?

Single-cell techniques offer promising avenues for GPM6B research:

  • scRNA-seq to identify cell populations with highest GPM6B expression

  • Spatial transcriptomics to map GPM6B expression patterns in intact tissue

  • Single-cell ATAC-seq to identify regulatory elements controlling GPM6B expression

  • Cell-specific CRISPR screens to identify interaction partners

  • Single-cell proteomics to correlate GPM6B protein levels with functional outcomes

These approaches could resolve conflicting findings by identifying cell-type specific roles for GPM6B that may differ between neuronal subtypes or brain regions.

What are the most promising translational applications of GPM6B research?

Based on current evidence, translational priorities include:

  • Targeting GPM6B-related pathways for treating impulsivity in psychiatric disorders

  • Exploring the regenerative potential in sensory systems, particularly hearing loss

  • Investigating GPM6B as a biomarker for suicide risk assessment

  • Examining GPM6B modulation as an approach to enhance behavioral flexibility

  • Development of therapeutic strategies targeting TGF-β-Smad2/3 signaling in GPM6B-expressing cells

Translational research should prioritize validation of findings across multiple model systems and careful consideration of potential off-target effects due to GPM6B's widespread expression in the nervous system.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.