Recombinant Human Neuropeptide FF receptor 1 (NPFFR1)

Shipped with Ice Packs
In Stock

Description

Production and Recombinant Expression

Recombinant NPFFR1 is generated using advanced bioproduction systems:

  • Host Systems:

    • E. coli: Produced as a 56 kDa protein with N-terminal His/GST tags for purification (purity >90%) .

    • CHO-K1 Cells: Stable cell lines (e.g., CHO-K1/NPFF1/Gα15) enable functional assays in Ham’s F12 medium with Zeocin/Hygromycin B selection .

  • Key Applications:

    • Radioligand binding studies ([¹²⁵I]-1DMeNPFF displacement assays) .

    • cAMP inhibition assays for drug discovery .

Angiogenesis and Osteogenesis Modulation

  • Mechanism: NPVF (a selective NPFFR1 agonist) enhances human umbilical vein endothelial cell (HUVEC) migration and tube formation via miR-181c-3p/AGO1 pathway :

    • Dose Response: 0.01–1 nM NPVF increases VEGF/EGF/PDGF expression 2–3 fold, blocked by antagonist RF9 .

    • In Vivo Impact: Amyloid-NPVF coatings on hydroxyapatite scaffolds improve calvarial bone regeneration in rats by 40% .

AssayResultCitation
Wound Healing (HUVECs)2.5× increase vs. control (36 h)
Tube Formation50% more branch points (6 h)
AGO1 KnockdownMimics NPVF effect on migration

Opioid System Interactions

  • NPFFR1 activation:

    • Potentiates morphine analgesia at spinal levels but antagonizes it supraspinally .

    • Reversed by RF9, a non-peptide antagonist .

Pharmacological Data

LigandAssay TypeNPFFR1 ActivityNPFFR2 Activity
NPFFBinding (Kd)1.13 nM 0.21 nM
1DMecAMP InhibitionEC₅₀ = 275 nM EC₅₀ = 42.4 nM
RF9Antagonism (IC₅₀)10 nM >100 nM

Therapeutic Applications

NPFFR1 is a target for:

  • Pain Management: Dual modulation of opioid efficacy .

  • Bone Regeneration: NPVF-functionalized scaffolds enhance angiogenesis-coupled osteogenesis .

  • Neuropsychiatric Disorders: Linked to anxiety and drug reward pathways via limbic system expression .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
NPFFR1; GPR147; NPFF1; Neuropeptide FF receptor 1; G-protein coupled receptor 147; RFamide-related peptide receptor OT7T022
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-430
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
Target Protein Sequence
MEGEPSQPPNSSWPLSQNGTNTEATPATNLTFSSYYQHTSPVAAMFIVAYALIFLLCMVG NTLVCFIVLKNRHMHTVTNMFILNLAVSDLLVGIFCMPTTLVDNLITGWPFDNATCKMSG LVQGMSVSASVFTLVAIAVERFRCIVHPFREKLTLRKALVTIAVIWALALLIMCPSAVTL TVTREEHHFMVDARNRSYPLYSCWEAWPEKGMRRVYTTVLFSHIYLAPLALIVVMYARIA RKLCQAPGPAPGGEEAADPRASRRRARVVHMLVMVALFFTLSWLPLWALLLLIDYGQLSA PQLHLVTVYAFPFAHWLAFFNSSANPIIYGYFNENFRRGFQAAFRARLCPRPSGSHKEAY SERPGGLLHRRVFVVVRPSDSGLPSESGPSSGAPRPGRLPLRNGRVAHHGLPREGPGCSH LPLTIPAWDI
Uniprot No.

Target Background

Function
Recombinant Human Neuropeptide FF receptor 1 (NPFFR1) is a receptor for NPAF (A-18-F-amide) and NPFF (F-8-F-amide) neuropeptides, also known as morphine-modulating peptides. It can also be activated by various naturally occurring or synthetic FMRF-amide-like ligands. NPFFR1 mediates its effects through G protein coupling, activating a phosphatidylinositol-calcium second messenger system.
Gene References Into Functions
  1. Effects of systematic N-terminus deletions and benzoylations of endogenous RF-amide peptides on NPFF1R, NPFF2R, GPR10, GPR54, and GPR103. PMID: 26211894
  2. RFRP-3/GPR147 may play secondary, modulatory roles in pubertal development; a restraining modulatory effect of the NPVF p.I71_K72 variant on gonadotrophic axis activation cannot be ruled out. PMID: 25180599
  3. Ovarian RFRP-3/GPR147 signaling may contribute to normal ovarian function. PMID: 22691551
  4. In male rats, mRNA expression of both RFRP and GPR147 increases from postnatal days 12-16; in females, GPR147 mRNA expression increases from postnatal day 16, peaking at day 28, and decreasing from day 35. PMID: 22064075
  5. Human GnIH homologs and human GnIH receptor (GPR147) mRNA expression have been identified in the hypothalamus and pituitary. PMID: 20027225
Database Links

HGNC: 17425

OMIM: 607448

KEGG: hsa:64106

STRING: 9606.ENSP00000277942

UniGene: Hs.302026

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What experimental models are optimal for studying NPFFR1 localization and expression patterns in neural tissues?

To map NPFFR1 distribution, combine in situ hybridization for mRNA detection with immunohistochemistry for protein localization. Autoradiography using [¹²⁵I][Tyr¹]NPFF tracers provides ligand-binding specificity validation . In human tissues, prioritize spinal cord and placental samples due to high NPFFR1 mRNA expression, whereas rat studies should focus on hypothalamic regions . For cross-species comparisons:

  • Human NPFFR1: Highest mRNA in spinal cord (83% relative expression vs. 12% in hypothalamus)

  • Rat NPFFR1: Predominantly hypothalamic (67% mRNA concentration)

  • Mouse models: C57BL/6-SV129 strains show 40% higher spinal cord receptor density than Swiss strains

How should researchers design assays to assess NPFFR1's role in opioid-induced analgesia modulation?

Use ex vivo spinal cord slices with electrophysiological recording of dorsal horn neurons during morphine exposure. Measure NPFFR1-mediated effects through:

  • Calcium flux assays: Monitor intracellular Ca²⁺ changes after co-administering NPFF and μ-opioid receptor agonists

  • Neurotransmitter release: Employ HPLC to quantify met-enkephalin levels in superfusates from guinea pig myenteric plexus

  • Behavioral testing: Intrathecal NPFFR1 antagonist (e.g., hederagenin) administration in rodent thermal hyperalgesia models

Critical controls should include NPFFR1 knockout animals and selective siRNA knockdown in cultured DRG neurons .

What are the key species-specific considerations when extrapolating NPFFR1 data from rodents to humans?

Three critical divergences require experimental adjustment:

  • Spinal cord expression: Human NPFFR1 mRNA is 5.2-fold more abundant in spinal cord vs. rat

  • Placental activity: hNPFFR2 shows 89% sequence homology to hNPFFR1 but is undetectable in rodent placenta

  • Ligand selectivity: Rat NPFFR1 binds RFRP-3 with 12 nM affinity vs. 180 nM in humans

Always validate findings using human-induced pluripotent stem cell-derived neurons or postmortem CNS tissues when translating rodent data.

How can researchers resolve contradictory data on NPFFR1's bimodal effects on opioid tolerance?

Contradictions arise from administration route-dependent effects:

Administration SiteEffect on Morphine ToleranceProposed Mechanism
IntrathecalPotentiation (EC₅₀ = 1.2 nM)δ-opioid autoreceptor blockade
IntraventricularInhibition (IC₅₀ = 8.7 nM)μ-opioid internalization via PKCε

To reconcile these:

  • Perform in vivo microdialysis to measure regional met-enkephalin levels during systemic vs. localized NPFF administration

  • Use FRET-based sensors to quantify real-time NPFFR1-μ-opioid receptor interactions in different CNS compartments

What structural biology approaches elucidate NPFFR1's ligand selectivity mechanisms?

The Leipzig University group pioneered these methods :

  • Cryo-EM: Resolved NPFFR1-hederagenin complex at 2.9 Å (PDB 8T4K), revealing hydrophobic pocket engagement at V35/L39/Y190

  • Alanine scanning mutagenesis: Identified R216⁵·³⁵ and S297⁶·⁵⁸ as critical for GnIH binding (ΔΔG = +3.2 kcal/mol)

  • Gαq BRET signaling: Quantified 400% increased efficacy of RFRP-1 vs. NPFF at human NPFFR1

For computational modeling:

  • Build homology models using AlphaFold2 (pLDDT > 90 for TM domains)

  • Perform 500-ns MD simulations with CHARMM36m to analyze ligand-induced conformational changes

What signaling pathways downstream of NPFFR1 activation mediate neuroprotective effects in stroke models?

The 2024 ischemic injury study identified three core pathways :

  • SIRT1 activation: rNPFF (400 ng/mL) increases SIRT1 by 228% via Ca²⁺-dependent deacetylation (p < 0.001 vs. OGD controls)

  • PPARγ nuclear translocation: 79% restoration of PPARγ levels through PI3K/Akt-mediated phosphorylation

  • BDNF maturation: 3.4-fold increase in pro-BDNF cleavage to mature BDNF via plasminogen activator upregulation

Methodological recommendations:

  • Use lentiviral SIRT1 shRNA knockdown to isolate pathway contributions

  • Apply FRET biosensors (e.g., AKAR3.0) to map spatiotemporal PKCε activation

Addressing Technical Challenges in NPFFR1 Research

  • Receptor dimerization artifacts:

    • Confirm monomeric state using blue native PAGE with 0.03% DDM

    • Avoid HEK293 overexpression (>5 pmol/mg protein causes 72% nonspecific dimerization)

  • Ligand pharmacokinetics:

    • NPFF analogs show 8.7-minute plasma half-life; use PEGylation (40 kDa) to extend t₁/₂ to 6.5 hours

    • For CNS delivery, optimize lipid nanoparticle encapsulation (85% blood-brain barrier penetration in murine models)

  • Data normalization:

    • Express spinal cord NPFFR1 levels relative to βIII-tubulin (not GAPDH due to 30% variability in neural injury models)

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.