Recombinant Human Neuropeptide FF receptor 2 (NPFFR2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock. However, if you have any specific requirement for the format, please remark your requirement when placing the order. We will prepare according to your demand.
Lead Time
Delivery time may differ from different purchasing channels or locations. Please consult your local distributors for specific delivery time.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate with us in advance and extra fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging this vial briefly prior to opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors including storage state, buffer ingredients, storage temperature and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize the development of the specified tag.
Synonyms
NPFFR2; GPR74; NPFF2; NPGPR; Neuropeptide FF receptor 2; G-protein coupled receptor 74; G-protein coupled receptor HLWAR77; Neuropeptide G-protein coupled receptor
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-522
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
Target Protein Sequence
MNSFFGTPAASWCLLESDVSSAPDKEAGRERRALSVQQRGGPAWSGSLEWSRQSAGDRRR LGLSRQTAKSSWSRSRDRTCCCRRAWWILVPAADRARRERFIMNEKWDTNSSENWHPIWN VNDTKHHLYSDINITYVNYYLHQPQVAAIFIISYFLIFFLCMMGNTVVCFIVMRNKHMHT VTNLFILNLAISDLLVGIFCMPITLLDNIIAGWPFGNTMCKISGLVQGISVAASVFTLVA IAVDRFQCVVYPFKPKLTIKTAFVIIMIIWVLAITIMSPSAVMLHVQEEKYYRVRLNSQN KTSPVYWCREDWPNQEMRKIYTTVLFANIYLAPLSLIVIMYGRIGISLFRAAVPHTGRKN QEQWHVVSRKKQKIIKMLLIVALLFILSWLPLWTLMMLSDYADLSPNELQIINIYIYPFA HWLAFGNSSVNPIIYGFFNENFRRGFQEAFQLQLCQKRAKPMEAYALKAKSHVLINTSNQ LVQESTFQNPHGETLLYRKSAEKPQQELVMEELKETTNSSEI
Uniprot No.

Target Background

Function
Receptor for NPAF (A-18-F-amide) and NPFF (F-8-F-amide) neuropeptides, also known as morphine-modulating peptides. Can also be activated by a variety of naturally occurring or synthetic FMRF-amide-like ligands. This receptor mediates its action through association with G proteins, which activate a phosphatidylinositol-calcium second messenger system.
Gene References Into Functions
  1. Effects of systematic N-terminus deletions and benzoylations of endogenous RF-amide peptides on NPFF1R, NPFF2R, GPR10, GPR54 and GPR103. PMID: 26211894
  2. The NPFF2 neuropeptide FF receptor phosphorylation sites have been mapped and their role identified in receptor regulation. PMID: 25326382
  3. These data demonstrate that NPFF-induced heterologous desensitization of MOP receptor signaling is mediated by GRK2 and could involve transphosphorylation within the heteromeric receptor complex. PMID: 22375000
  4. Four genetic loci were strongly and independently associated with obesity: NPY2R, NPFFR2, MC4R, and FTO. PMID: 21818152
  5. Besides regulating reproduction, kisspeptins have the potential to mediate physiological effects on autonomic regulation and nociception in humans via the NPFF2R pathways. PMID: 20600636
  6. Species-related differences in the binding properties of NPFF(2) receptors have been observed. PMID: 19944730
  7. Evidence does not support the hypothesis that NPGPR is involved in feeding regulation. PMID: 12609745
  8. The BIBP3226 and PFR(Tic)amide, on Human neuropeptide FF receptor subtype 2 (hNPFF2) were investigated. PMID: 15127947
  9. Neuropeptide FF analogs show that NPFF2 receptors couple to the four subunits assayed. PMID: 15608144
  10. Expression of hNPFF2 receptor mRNA was up-regulated by neuropeptide FF. PMID: 16336216
  11. The NPFF system may also exhibit species-specific features, as the NPFF2 receptor mRNA expression differs from that reported for rats. PMID: 17157836
  12. Findings suggest that a common haplotype in the GPR74 gene protects against obesity, which, in part, is caused by a relief of inhibition of lipid mobilization from adipose tissue. PMID: 17503329
  13. We identified hFF2 positive neurons in the forebrain and medulla oblongata of individuals who died suddenly. PMID: 18565622
Database Links

HGNC: 4525

OMIM: 607449

KEGG: hsa:10886

STRING: 9606.ENSP00000307822

UniGene: Hs.99231

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Isoform 1 is abundant in placenta. Relatively highly expressed in thymus, testis, and small intestine. Expressed at low levels in several tissues including spleen, prostate, brain, heart, ovary, colon, kidney, lung, liver and pancreas and not expressed in

Q&A

What is the molecular structure of NPFFR2 and how does it recognize its ligands?

NPFFR2 is a G-protein-coupled receptor that plays crucial roles in pain modulation and diet-induced thermogenesis. Recent cryo-electron microscopy (cryo-EM) studies at 3.2 Å resolution have revealed that NPFFR2 adopts the canonical active conformation of a class A GPCR when coupled to a G-protein. The structure shows that NPFFR2 recognizes RF-amide peptides through:

  • C-terminal RF-amide moiety engagement with conserved residues in the transmembrane domain

  • N-terminal segment interaction in a receptor subtype-specific manner

  • Extracellular loop 2 (ECL2) organization into four β-strands (β2-β5), with an additional β1 strand formed by residues 32-36 in the N-terminal tail

When examining NPFFR2-ligand interactions, researchers should focus on the β-sheet structures in ECL2, which are stabilized by a conserved disulfide bond between Cys3.25 on TM3 and Cys45.50 on ECL2. This structure differs from related receptors like NPY2R, highlighting its unique ligand recognition mechanism .

How does NPFFR2 differ functionally from NPFFR1?

Despite high sequence similarity (84% in the transmembrane domain and 68% in ECL2), NPFFR1 and NPFFR2 exhibit distinct ligand preferences and physiological functions:

FeatureNPFFR2NPFFR1
Primary ligandsStrongly activated by neuropeptides FF (NPFFs)Activated by RF-amide-related peptides (RFRPs)
Activity with cross-ligandsLow activity with RFRPsLimited cross-reactivity with NPFFs
Primary physiological rolesPain modulation, diet-induced thermogenesisRegulation of reproductive hormone balance
Key binding pocket characteristicsHydrophobic pocket for F(-6)SF and polar environment for Q(-5)SFPolar residues near N(-6)GnIH and nonpolar residues near L(-5)GnIH

The selectivity appears determined by hydrophilicity differences in the ligand-binding pocket, particularly involving amino acids at the 5th and 6th positions from the C-terminus of ligands .

What experimental approaches can be used to study NPFFR2 function in vivo?

Several established experimental approaches have proven effective:

  • NPFFR2 knockout mouse models:

    • Enable evaluation of physiological responses in metabolic, pain, and behavioral assays

    • Allow investigation of specific pathways through molecular and biochemical analyses

  • Behavioral assessments:

    • Open field test and elevated plus maze for anxiety-like behaviors

    • Hot plate test for pain perception

    • Forced swimming test and sucrose preference test for depressive-like behaviors

  • Metabolic phenotyping:

    • Glucose tolerance tests in standard and high-fat diet conditions

    • Brown adipose tissue thermogenic capacity measurements

  • Molecular analyses:

    • qPCR for measuring expression of related genes (e.g., 5-HT1AR, TLR4, TNF-α)

    • Analysis of UCP-1 and PGC-1α levels in brown adipose tissue

For comprehensive characterization of NPFFR2 function, researchers should combine multiple approaches rather than relying on isolated assays, as NPFFR2 mediates interconnected physiological systems.

What specific structural features determine ligand selectivity between NPFFR1 and NPFFR2?

The 2025 cryo-EM structure of the hNPSF–NPFFR2–Gi complex provides crucial insights into the molecular basis of ligand selectivity:

The hydrophilicity of the ligand-binding pocket, particularly involving amino acids at the 5th and 6th positions from the C-terminus of RF-amide peptides, is the critical determinant. Specifically:

  • NPFFR2 selectivity determinants:

    • A hydrophobic pocket formed by V35^Nt, L39^Nt, Y190^ECL2, and I312^7.32 accommodates F(-6)^SF

    • A polar environment created by R216^5.35, S297^6.58, N311^7.31, and Y315^7.35 accommodates Q(-5)^SF

  • NPFFR1 selectivity determinants:

    • A more polar environment (S33^Nt, Q37^Nt, T106^ECL1, S202^ECL2) preferentially interacts with N(-6)^GnIH

    • A hydrophobic region (I293^6.58, T307^7.31, F311^7.35) better accommodates L(-5)^GnIH

Mutagenesis studies confirmed these selectivity determinants: a triple mutant of NPFFR1 (Q37^Nt→L, I293^6.58→S, T307^7.31→N) exhibited reversed selectivity with a 30-fold decrease in affinity for GnIH and a 2-fold increase in affinity for hNPSF .

For structure-based drug design, researchers should focus on these key residues to develop selective compounds for either receptor subtype.

What is the activation mechanism of NPFFR2 upon ligand binding?

Comparison between ligand-free and active states of NPFFR2 reveals a multi-step activation mechanism:

  • Initial binding: The C-terminal RF-amide motif engages with conserved residues in the transmembrane domain pocket

  • Conformational changes in extracellular domains:

    • Inward movements of ECL2, ECL3, and the extracellular segments of TM6 and TM7

    • Formation of specific interactions with the N-terminal segment of the RF-amide peptide

    • β-strands of ECL2 and the N-terminus shift toward the ligand, creating a hydrophobic interaction network

  • Ligand trapping: TM6, TM7, and ECL3 move toward ECL2 and N-tail, effectively trapping the ligand

  • TM3-mediated activation: Binding of the RF-amide motif triggers TM3-mediated conformational changes

  • Canonical GPCR activation: 7 Å outward movement of the cytoplasmic segment of TM6 in the active state

The interface between NPFFR2 and Gαi measures 774 Ų, mainly mediated through the α5 helix of the Gαi subunit and the transmembrane domain of the receptor .

How does NPFFR2 signaling influence neuroinflammation and depressive behaviors?

NPFFR2 appears to be a critical mediator in the pathway connecting neuroinflammation to depressive-like behaviors:

  • LPS-induced neuroinflammatory response:

    • In wild-type mice, LPS injection increases toll-like receptor 4 (TLR4) and tumor necrosis factor-α (TNF-α) mRNA in the ventral hippocampus

    • NPFFR2 knockout mice do not show these inflammatory changes after LPS treatment

  • Serotonergic system modulation:

    • LPS treatment reduces 5-HT1AR mRNA levels in the ventral hippocampus of wild-type mice

    • This reduction does not occur in NPFFR2 knockout mice

    • Silencing of ventral-hippocampal 5-HT1AR mRNA induces anhedonia in LPS-treated NPFFR2-KO mice

  • Behavioral outcomes:

    • NPFFR2 knockout prevents LPS-induced depressive-like behaviors:

      • Maintained sucrose preference (hedonic response)

      • No increase in immobility time in forced swim test

This suggests NPFFR2 acts as a critical link between inflammatory stimuli and serotonergic plasticity in the ventral hippocampus. Researchers investigating neuroinflammatory mechanisms of depression should consider targeting NPFFR2 signaling pathways, particularly in relation to 5-HT1AR modulation.

What role does NPFFR2 play in energy homeostasis and metabolic regulation?

NPFFR2 is a master regulator of diet-induced adaptive thermogenesis that couples energy homeostasis with energy partitioning:

  • Diet-induced thermogenesis:

    • NPFFR2-/- mice fed a high-fat diet (HFD) display exacerbated obesity

    • This is associated with failure to activate brown adipose tissue (BAT) thermogenic response to energy excess

    • Cold-induced BAT thermogenesis remains unaffected, indicating a specific defect in diet-induced thermogenesis

  • Hypothalamic circuitry:

    • NPFFR2 signaling is required to maintain basal arcuate nucleus NPY mRNA expression

    • This establishes a novel hypothalamic NPY-dependent circuitry for energy homeostasis

  • Molecular consequences:

    • Lack of NPFFR2 signaling in HFD conditions leads to:

      • Significantly lower UCP-1 levels in BAT

      • Decreased PGC-1α levels in BAT

      • Severe glucose intolerance that is exacerbated by HFD

This indicates NPFFR2 is part of a specific neuronal circuit that detects caloric excess and triggers appropriate thermogenic responses. Researchers investigating metabolic disorders should consider NPFFR2 as a potential therapeutic target for obesity and related conditions.

What are the therapeutic implications of NPFFR2 structural insights for drug development?

The detailed structural understanding of NPFFR2 provides several strategic approaches for drug development:

  • Enhanced receptor subtype selectivity:

    • The identified structural differences between NPFFR1 and NPFFR2 enable design of more selective ligands

    • Key focus areas should be residues forming the hydrophobic pocket (V35^Nt, L39^Nt, Y190^ECL2, I312^7.32) and the polar environment (R216^5.35, S297^6.58, N311^7.31, Y315^7.35)

  • Bifunctional drug development:

    • Based on NPFFR2's role in opioid modulation, bifunctional drugs targeting both opioid receptors and NPFFR2 show promise

    • Previous compounds (BN-9, DN-9) demonstrated efficacy but lacked precise selectivity

    • New structure enables more selective multitarget drug design

  • Therapeutic opportunities:

    • Pain management: antinociception without tolerance development

    • Depression: targeting NPFFR2 to prevent neuroinflammation-induced depression

    • Metabolic disorders: addressing diet-induced thermogenesis defects

    • Opioid side effects: reducing hyperalgesia, tolerance, and constipation

  • Structure-guided modifications:

    • Different ligand binding modes can be exploited to create biased agonists

    • Understanding the TM3-mediated activation mechanism provides opportunities for allosteric modulators

The combination of structural insights and phenotypic understanding from knockout studies provides a comprehensive foundation for targeted drug discovery programs focusing on NPFFR2.

What are optimal expression systems for producing recombinant NPFFR2 for structural studies?

Based on recent successful structural determination of NPFFR2:

  • Expression system selection:

    • Insect cell expression (Sf9 cells) provides appropriate post-translational modifications

    • Baculovirus expression system with optimized signal sequences improves membrane targeting

  • Construct optimization:

    • For ligand-bound studies: Wild-type NPFFR2 with minimal modifications

    • For ligand-free studies: Replacement of ICL3 region (residues 246-266) with cytochrome b562 RIL (BRIL)

    • Addition of C-terminal purification tags (e.g., His-tag) with appropriate linkers

  • Stabilization strategies:

    • For active state: Co-expression or assembly with heterotrimeric Gi and stabilization with scFv16

    • For inactive state: Complexation with anti-BRIL Fab and anti-Fab nanobody (NbFab)

  • Purification approach:

    • Solubilization with appropriate detergents (e.g., lauryl maltose neopentyl glycol)

    • Affinity chromatography followed by size-exclusion chromatography

    • Quality control via monodispersity assessment using analytical size-exclusion chromatography

This expression and purification strategy has successfully yielded NPFFR2 samples suitable for high-resolution cryo-EM structural determination.

How should researchers design assays to evaluate NPFFR2 ligand selectivity?

To properly characterize ligand selectivity between NPFFR1 and NPFFR2:

  • Competitive binding assays:

    • Use radiolabeled reference ligands for each receptor (e.g., [125I]-NPFF for NPFFR2)

    • Comparative displacement curves with a panel of RF-amide peptides (NPFFs and RFRPs)

    • Analysis of IC50 values and binding affinities (Ki)

  • Functional signaling assays:

    • G-protein dependent signaling: Gi/o coupling measurement through inhibition of forskolin-stimulated cAMP production

    • Comparison of EC50 values between NPFFR1 and NPFFR2 for various ligands

    • Evaluation of maximal response (Emax) to determine full vs. partial agonism

  • Structure-activity relationship studies:

    • Synthetic peptide analogs with systematic modifications at the 5th and 6th positions from the C-terminus

    • Point mutations in receptor binding pockets focusing on identified selectivity determinants

    • Assessment of how polar/hydrophobic substitutions affect binding preferences

  • Cross-validation approaches:

    • Comparison of in vitro binding with cell-based functional assays

    • Verification in primary cell cultures expressing endogenous receptors

    • Correlation with in vivo pharmacological effects in wild-type vs. knockout models

These comprehensive approaches allow for proper characterization of receptor selectivity profiles and identification of key structural determinants of ligand recognition.

What techniques can be used to investigate the interaction between NPFFR2 and the opioid receptor system?

Given the therapeutic significance of NPFFR2 in modulating opioid effects, several approaches can elucidate these interactions:

  • Co-expression and co-localization studies:

    • Immunohistochemistry to identify neuronal populations co-expressing NPFFR2 and opioid receptors

    • Single-cell RNA sequencing to characterize transcriptional profiles of neurons expressing both receptor types

    • FRET/BRET assays to detect potential heteromerization between receptors

  • Cross-signaling analysis:

    • Examination of signaling pathway modulation when both receptor types are activated

    • Investigation of changes in G-protein coupling efficiency

    • Assessment of β-arrestin recruitment and receptor internalization dynamics

  • In vivo interaction models:

    • Combined administration of NPFFR2 and opioid receptor ligands

    • Evaluation of analgesic effects, tolerance development, and side effects

    • Assessment in wild-type vs. NPFFR2 knockout animals

  • Multitarget drug evaluation:

    • Testing bifunctional ligands targeting both NPFFR2 and opioid receptors

    • Characterization of binding profiles, signaling responses, and physiological effects

    • Comparison with co-administration of selective ligands for each receptor

By employing these techniques, researchers can elucidate the molecular mechanisms underlying the observed interactions between NPFFR2 and opioid systems, potentially leading to improved pain management strategies with reduced side effects.

How can researchers reconcile the diverse physiological roles of NPFFR2?

NPFFR2 exhibits seemingly disparate functions across pain, metabolism, and mood regulation that require careful interpretation:

  • Integrated neural circuit perspective:

    • NPFFR2 likely functions within multiple distinct neural circuits

    • Each circuit may involve different downstream effectors despite shared NPFFR2 activation

    • Circuit-specific responses explain why NPFFR2 can independently regulate:

      • Pain modulation through interaction with opioid systems

      • Diet-induced thermogenesis via hypothalamic NPY pathways

      • Neuroinflammation-induced depression through 5-HT1AR modulation

  • Methodological approach to reconciliation:

    • Tissue-specific conditional knockout models rather than global knockouts

    • Cell type-specific manipulations using Cre-lox technology

    • Temporal control of receptor manipulation to distinguish developmental from acute effects

    • Careful consideration of compensatory mechanisms in knockout models

  • Data integration strategy:

    • Cross-reference findings from different physiological systems

    • Identify common molecular pathways (e.g., G-protein signaling cascades)

    • Develop comprehensive models that account for both central and peripheral NPFFR2 functions

When interpreting experimental results, researchers should consider these diverse roles not as contradictory but as reflective of NPFFR2's involvement in multiple physiological systems, potentially through shared molecular mechanisms applied in different anatomical contexts.

What explains the apparent contradictions in NPFFR2 agonist and antagonist effects in different studies?

The literature contains seemingly contradictory findings regarding NPFFR2 ligand effects that can be explained by several factors:

  • Route of administration differences:

    • Central (intracerebroventricular) vs. peripheral (intraperitoneal) administration

    • Different blood-brain barrier penetration properties of compounds

    • Site-specific effects depending on local receptor expression patterns

  • Dose-dependent effects:

    • Biphasic responses where low and high doses produce opposite effects

    • Receptor desensitization or internalization at high concentrations

    • Engagement of different signaling pathways at different concentrations

  • Ligand-specific biased signaling:

    • Different NPFFR2 ligands may preferentially activate distinct signaling pathways

    • Some compounds may act as biased agonists or partial agonists

    • RF9, classified as a partial agonist, often exhibits antagonist-like effects in some experimental models

  • Experimental context variations:

    • Baseline physiological state (e.g., normal vs. inflammatory pain models)

    • Presence of endogenous opioids or stress hormones

    • Duration of treatment (acute vs. chronic)

Researchers should carefully document and consider these factors when designing experiments and interpreting results, particularly when comparing findings across different studies or developing therapeutic applications.

How should researchers interpret data from NPFFR2 knockout studies in the context of potential compensatory mechanisms?

Knockout studies provide valuable insights but require careful interpretation:

  • Common compensatory adaptations:

    • Upregulation of NPFFR1 expression or sensitivity

    • Alterations in endogenous ligand production

    • Engagement of parallel signaling pathways

    • Developmental compensations distinct from acute receptor blockade effects

  • Methodological approaches to address compensation:

    • Compare constitutive knockouts with inducible or conditional knockouts

    • Complement genetic approaches with pharmacological interventions

    • Examine temporal progression of phenotypes following inducible deletion

    • Measure expression changes in related receptors and signaling molecules

  • Phenotype interpretation framework:

    • Positive findings (observed phenotypes) are generally reliable

    • Negative findings (lack of phenotype) should be interpreted with caution

    • Partial phenotypes may reflect incomplete compensation

    • Sex-specific differences may reveal different compensatory capabilities

For example, while NPFFR2 knockout prevents LPS-induced depressive-like behaviors, this finding is strengthened by the observation that 5-HT1AR silencing restores susceptibility to these behaviors, suggesting a specific mechanism rather than general compensation .

By employing these interpretive frameworks, researchers can extract meaningful insights from knockout studies while appropriately acknowledging their limitations.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.