Recombinant Human Neuropeptides B/W receptor type 2 (NPBWR2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them in your order. We will fulfill your request to the best of our ability.
Lead Time
Delivery times may vary depending on the purchase method and location. Please consult your local distributor for specific delivery estimates.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure all contents settle to the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by multiple factors including storage conditions, buffer components, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize its development.
Synonyms
NPBWR2; GPR8; Neuropeptides B/W receptor type 2; G-protein coupled receptor 8
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-333
Protein Length
Full length protein
Species
Homo sapiens (Human)
Target Names
Target Protein Sequence
MQAAGHPEPLDSRGSFSLPTMGANVSQDNGTGHNATFSEPLPFLYVLLPAVYSGICAVGL TGNTAVILVILRAPKMKTVTNVFILNLAVADGLFTLVLPVNIAEHLLQYWPFGELLCKLV LAVDHYNIFSSIYFLAVMSVDRYLVVLATVRSRHMPWRTYRGAKVASLCVWLGVTVLVLP FFSFAGVYSNELQVPSCGLSFPWPEQVWFKASRVYTLVLGFVLPVCTICVLYTDLLRRLR AVRLRSGAKALGKARRKVTVLVLVVLAVCLLCWTPFHLASVVALTTDLPQTPLVISMSYV ITSLSYANSCLNPFLYAFLDDNFRKNFRSILRC
Uniprot No.

Target Background

Function
This protein interacts specifically with a range of opioid ligands. It serves as a receptor for neuropeptides B and W, potentially playing a role in neuroendocrine system regulation, food intake, and the integration of other signals.
Gene References Into Functions
  1. Primarily expressed in the brain or pituitary. PMID: 27399877
Database Links

HGNC: 4530

OMIM: 600731

KEGG: hsa:2832

STRING: 9606.ENSP00000358783

UniGene: Hs.248118

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Detected at high levels in caudate nucleus, hyppocampus and amygdala; at moderate levels in the adult brain, thalamus, parietal cortex, pituitary gland, adrenal gland and lymph nodes.

Q&A

What is NPBWR2 and how does it relate to its evolutionary origins?

NPBWR2 was originally identified as an orphan receptor called GPR8, which shares approximately 70% nucleotide identity and 64% amino acid identity with NPBWR1 (formerly GPR7). Following the discovery of its endogenous ligands, GPR8 was reclassified by IUPHAR as Neuropeptide B/W receptor-2 (NPBWR2) . Both receptors have relatively high sequence similarities with opioid and somatostatin receptors, suggesting evolutionary relationships between these G protein-coupled receptor systems .

The evolutionary history of NPBWR2 is particularly interesting as it appears to have emerged relatively recently through gene duplication events. Phylogenetic analysis indicates that while NPBWR1 is highly conserved across both humans and rodents, NPBWR2 is found only in humans and other primates, with no functional ortholog identified in rodent genomes . This species-specific distribution suggests that the NPBWR2 gene evolved after the divergence of rodent and primate lineages, making it a relatively young receptor from an evolutionary perspective.

What are the endogenous ligands for NPBWR2 and how do they function?

Two endogenous peptide ligands for NPBWR2 were identified between 2002 and 2003: neuropeptide B (NPB) and neuropeptide W (NPW) . NPB consists of 29 amino acids with a distinctive brominated N-terminal tryptophan moiety that contributes to its unique pharmacological properties . NPW exists in two forms: NPW23 and NPW30, consisting of 23 and 30 amino acid residues respectively .

Both NPB and NPW bind and activate NPBWR2 with similar nanomolar affinities, indicating high potency at this receptor . The binding mechanism involves interaction with specific domains of the receptor, leading to conformational changes that trigger downstream signaling cascades. These peptides have been implicated in multiple physiological processes including regulation of feeding behavior, energy homeostasis, neuroendocrine function, and modulation of inflammatory pain . Understanding the precise binding characteristics and activation mechanisms of these ligands is essential for developing selective modulators of NPBWR2 activity.

How does NPBWR2 signaling differ from related neuropeptide receptors?

Unlike many related neuropeptide receptors that have been extensively characterized pharmacologically, NPBWR2 remains relatively understudied. While selective ligands have been developed for receptors like the neuropeptide Y (NPY) receptor family, the development of NPBWR2-selective compounds has progressed more slowly . This is partly due to challenges in expressing functional recombinant receptor and the lack of rodent models for in vivo testing.

When comparing NPBWR2 signaling with its closest relative NPBWR1, both receptors respond to the same endogenous ligands but may show differences in tissue distribution, signaling efficiency, and downstream pathway activation. These differences could contribute to distinct physiological roles despite their structural similarities and shared ligands.

What expression systems are optimal for recombinant NPBWR2 studies?

For successful recombinant NPBWR2 studies, researchers should consider several expression systems, each with distinct advantages. Chinese Hamster Ovary (CHO) cells have been widely used in neuropeptide receptor research and provide a reliable system for stable expression of GPCRs. These cells were successfully employed in the original deorphaning of NPBWR1 and NPBWR2, where they were used to measure decreases in forskolin-induced cAMP production as the functional readout for receptor activation .

Human Embryonic Kidney (HEK293) cells represent another valuable expression system, particularly useful when studying human NPBWR2 due to their human origin and robust protein expression machinery. For higher throughput screening approaches, cell lines stably expressing NPBWR2 coupled to various reporter systems (such as luciferase or fluorescent proteins linked to cAMP or calcium signaling) can be developed.

When establishing an expression system, researchers should carefully optimize transfection conditions and confirm receptor expression through techniques such as Western blotting, flow cytometry, or fluorescence microscopy with appropriate antibodies or tagged receptor constructs. Functional validation through dose-response studies with known ligands (NPB and NPW) is essential to ensure the expressed receptor maintains proper pharmacological properties.

What are the recommended functional assays for evaluating NPBWR2 activity?

Multiple complementary assays should be employed to comprehensively characterize NPBWR2 activity, as different assays may reveal distinct aspects of receptor function and ligand properties. For primary screening and pharmacological characterization, researchers commonly use G protein-dependent signaling assays. Since NPBWR2 predominantly couples to Gi/o proteins, measuring inhibition of forskolin-induced cAMP accumulation provides a direct assessment of receptor activation .

Beyond G protein signaling, β-arrestin recruitment assays offer valuable insights into receptor regulation and potential signaling bias. Technologies such as enzyme complementation assays, BRET (Bioluminescence Resonance Energy Transfer), or FRET (Fluorescence Resonance Energy Transfer) can be employed to monitor β-arrestin recruitment in real-time. The table below summarizes key functional assays used for characterizing compounds at related receptors:

Assay TypeReadoutApplicationExample from Literature
cAMP InhibitionDecrease in forskolin-induced cAMPG protein (Gi/o) couplingUsed for initial deorphaning of NPBWR2
IP-1 AccumulationIncrease in IP-1 levelsG protein (Gq) couplingUsed to characterize compound 17 at NMUR2
β-Arrestin RecruitmentProtein-protein interactionReceptor internalizationEC50 values for various ligands at NMUR1/2
Receptor BindingDisplacement of labeled ligandAffinity determinationCommon approach for antagonist screening

Researchers should note that functional responses may vary depending on the cell type and assay conditions. Therefore, standardization and inclusion of appropriate positive and negative controls are essential for reliable data interpretation.

How can researchers characterize antagonists for NPBWR2?

Characterizing antagonists for NPBWR2 requires a systematic approach combining binding and functional studies. Initially, researchers should establish robust agonist-induced responses using endogenous ligands (NPB or NPW) at concentrations that produce 70-80% of the maximal response. Potential antagonists can then be evaluated for their ability to inhibit these responses in a concentration-dependent manner.

A comprehensive antagonist characterization should include:

  • Determination of binding affinity through competition binding assays with radiolabeled or fluorescently labeled NPB/NPW

  • Evaluation of functional antagonism in multiple signaling pathways (G protein and β-arrestin)

  • Assessment of antagonist selectivity by testing against related receptors, particularly NPBWR1

  • Determination of antagonist mechanism (competitive, non-competitive, or allosteric)

Recent research with compound 17, which was found to antagonize neuropeptide W23 signaling at human NPBWR1 with an IC50 of 2.6 μM, illustrates the approach to antagonist characterization . This compound demonstrates how molecules designed for one receptor (in this case, NMUR2 agonism) may unexpectedly exhibit antagonistic activity at other receptors like NPBWR1. Similar approaches could identify compounds with antagonistic activity at NPBWR2.

For complete characterization, Schild analysis or global fitting of concentration-response curves in the presence of increasing antagonist concentrations should be performed to distinguish competitive from non-competitive mechanisms and determine antagonist potency (pA2 or KB values).

How can researchers distinguish between NPBWR1 and NPBWR2 activities in experimental systems?

Distinguishing between NPBWR1 and NPBWR2 activities presents a significant challenge due to their structural similarity and shared endogenous ligands. A multifaceted approach is necessary to delineate receptor-specific functions. First, researchers should employ selective expression systems where only one receptor subtype is present. This can be achieved through heterologous expression in cell lines that lack endogenous expression of either receptor or through CRISPR/Cas9-mediated knockout of one receptor in cells expressing both subtypes.

For pharmacological discrimination, efforts should focus on identifying ligands with differential affinities or efficacies. While both NPB and NPW activate both receptors, subtle differences in potency or signaling kinetics may exist that could be exploited. Researchers should systematically evaluate structure-activity relationships of modified peptides to identify regions that confer selectivity for one receptor over the other.

When studying tissues or cell types that potentially express both receptors, molecular approaches such as receptor-specific siRNA knockdown or antisense oligonucleotides can help attribute observed effects to specific receptor subtypes. Additionally, species differences can be advantageous—since rodents lack NPBWR2, any effects of NPB/NPW in rodent systems can be attributed to NPBWR1, providing a useful comparison point.

What cross-reactivity issues should researchers be aware of when studying NPBWR2?

When investigating NPBWR2, researchers must be vigilant about potential cross-reactivity with structurally or functionally related receptors. Beyond the obvious similarity with NPBWR1, NPBWR2 shares structural features with opioid and somatostatin receptors . This evolutionary relationship can lead to unexpected pharmacological overlaps.

A striking example of cross-reactivity is observed with compound 17, which was designed as an NMUR2 agonist but unexpectedly showed antagonistic activity at NPBWR1 (IC50 = 2.6 μM) . This compound also demonstrated antagonism at other receptors including human OPRM1 (opioid receptor) and PRLHR (prolactin-releasing hormone receptor), highlighting the potential for promiscuous interactions across different receptor families .

The table below illustrates cross-reactivity observed with compound 17:

ReceptorPrimary FunctionCompound 17 ActivityIC50 Value
NMUR2Agonist (intended target)AgonistEC50 = 6.9 nM (β-Arr)
NPBWR1Antagonist of neuropeptide W23 signalingAntagonistIC50 = 2.6 μM
OPRM1Antagonist of Met-enkephalin signalingAntagonistIC50 = 1.2 μM
PRLHR (GPR10)AntagonistAntagonistIC50 = 1.6 μM
NPBWR2Not reportedNot observed up to 1 μM>1 μM

To address cross-reactivity concerns, researchers should implement comprehensive counter-screening against a panel of related receptors when characterizing novel ligands. Additionally, experimental design should include appropriate controls to distinguish specific NPBWR2-mediated effects from those potentially involving other receptors.

How do species differences impact translational research with NPBWR2?

The absence of NPBWR2 in rodents represents one of the most significant challenges for translational research in this field . This species difference severely limits the use of conventional rodent models for studying NPBWR2 biology and evaluating potential therapeutic agents targeting this receptor. Researchers must carefully consider these limitations when designing experiments and interpreting results.

For in vitro studies, human cell lines or primary cells should be used whenever possible to ensure relevance to human NPBWR2 biology. When considering in vivo approaches, several strategies can be employed to overcome the species barrier:

  • Development of humanized mouse models expressing human NPBWR2 under appropriate promoters

  • Utilization of non-human primate models for specific studies, where ethical and practical considerations permit

  • Employment of alternative approaches such as human induced pluripotent stem cell (iPSC)-derived neurons or organoids to model human NPBWR2 function in relevant cellular contexts

Researchers should also be aware that species differences may extend beyond the mere presence or absence of the receptor. Even when working with human NPBWR2, differences in the cellular environment, signaling machinery, or receptor regulation between experimental systems and the human physiological context may influence translational relevance. Careful validation of findings across multiple experimental platforms can help mitigate these concerns.

What evidence supports NPBWR2's role in energy homeostasis and feeding behavior?

The NPB/NPW system has been implicated in the regulation of feeding behavior and energy homeostasis, though specific roles of NPBWR2 in these processes remain to be fully elucidated . This association places NPBWR2 among other neuropeptide receptors, such as NPY receptors, that play critical roles in metabolic regulation .

Evidence supporting NPBWR2's involvement in energy homeostasis comes primarily from studies of the NPB/NPW system as a whole. The structurally related NPBWR1 has been more extensively characterized in this context, with NPBWR1-null mice demonstrating late-onset obesity with a hyperphagic phenotype . Since NPBWR2 shares the same endogenous ligands and has similar signaling properties, it may participate in parallel or complementary pathways regulating energy balance in humans.

For researchers investigating NPBWR2's role in metabolism, methodological approaches should include:

  • Detailed expression analysis of NPBWR2 in hypothalamic nuclei and peripheral tissues involved in energy homeostasis

  • Functional studies using selective agonists/antagonists in cellular models expressing NPBWR2

  • Correlation studies between NPBWR2 genetic variants and metabolic phenotypes in human populations

  • Investigation of potential interactions between NPBWR2 and other metabolic regulatory systems

Understanding NPBWR2's contribution to energy homeostasis could potentially inform novel therapeutic strategies for metabolic disorders, similar to how NPY receptor modulators have been explored for obesity treatment .

How might NPBWR2 be involved in pain modulation and neuroinflammatory processes?

The NPB/NPW system has been implicated in modulating inflammatory pain, suggesting potential roles for their receptors, including NPBWR2, in pain processing pathways . This function places NPBWR2 among other neuropeptide systems with dual roles in both energy homeostasis and nociception.

The mechanisms through which NPBWR2 might modulate pain perception could involve:

  • Direct modulation of nociceptive neuron excitability in primary sensory neurons

  • Regulation of neurotransmitter release in pain processing centers of the spinal cord and brain

  • Modulation of neuroinflammatory processes that contribute to pain sensitization

  • Interactions with other pain-regulating systems such as opioid and cannabinoid pathways

The structural and functional similarities between NPBWR2 and opioid receptors suggest potential overlaps in their roles in pain modulation. This is further supported by the observation that compound 17 demonstrates antagonistic activity at both NPBWR1 and opioid receptors (OPRM1) , suggesting potential pharmacological interactions between these systems.

For researchers investigating NPBWR2's role in pain, approaches should include expression analysis in sensory ganglia and pain processing centers, functional studies in sensory neuron cultures, and where possible, evaluation of NPBWR2-selective compounds in humanized animal models or human experimental pain paradigms.

What is known about NPBWR2's neuroendocrine functions and stress responses?

The NPB/NPW system has been linked to neuroendocrine regulation, suggesting NPBWR2 may participate in coordinating hormonal responses to various physiological challenges . The study of mesolimbic neuropeptide systems indicates they play crucial roles in coordinating stress responses , and NPBWR2 may contribute to these processes in humans.

The structurally related NPBWR1 has been shown to influence autonomic responses to physical stress, as demonstrated by abnormal autonomic responses in NPBWR1-null mice . Since NPBWR2 shares the same endogenous ligands and has similar pharmacological properties, it may play complementary or parallel roles in stress adaptation in primates.

An interesting potential function of NPBWR2 relates to social cognition and emotional processing. Single nucleotide polymorphisms (SNPs) in the human NPBWR1 gene have been associated with altered evaluation of facial expressions , suggesting these receptors participate in social information processing. Given the evolutionary emergence of NPBWR2 in primates coincident with their complex social structures, NPBWR2 may have specialized functions in human social behavior and stress responses.

For researchers investigating NPBWR2's neuroendocrine functions, approaches should include expression analysis in relevant brain regions (hypothalamus, amygdala, BNST), functional studies examining effects on hormone release, and investigation of potential interactions with other stress response systems such as the hypothalamic-pituitary-adrenal axis.

What strategies can accelerate the development of selective NPBWR2 ligands?

Developing selective ligands for NPBWR2 represents a significant challenge but is essential for advancing understanding of this receptor's functions. Current approaches to accelerate NPBWR2 ligand development should combine computational, medicinal chemistry, and high-throughput screening methodologies.

Structure-based drug design employing homology modeling based on related GPCRs with known crystal structures can provide valuable insights into the structural features of NPBWR2's binding pocket. These models can be refined using data from site-directed mutagenesis experiments that identify critical residues for ligand binding and selectivity.

Peptide-based approaches remain valuable, starting with systematic modifications of the endogenous ligands NPB and NPW. Alanine scanning, truncation analysis, and incorporation of non-natural amino acids can identify minimal pharmacophores and regions that confer selectivity. These modified peptides can then serve as leads for the development of peptidomimetics with improved pharmacokinetic properties.

High-throughput screening using functional assays in NPBWR2-expressing cell lines can identify novel chemical scaffolds with activity at this receptor. The successful development of small molecule ligands for other peptide receptors, such as NPY receptor antagonists , provides precedent for this approach. Fragment-based drug discovery, which identifies low molecular weight compounds with weak binding that can be optimized through medicinal chemistry, offers another promising strategy.

How does the complex pharmacology of NPBWR2 impact potential therapeutic applications?

The complex pharmacology of NPBWR2 presents both challenges and opportunities for therapeutic development. Like many GPCRs, NPBWR2 likely exhibits functional selectivity (biased signaling), where different ligands may preferentially activate specific downstream pathways. Understanding this complexity is essential for developing therapeutics with optimal efficacy and side effect profiles.

The case of compound 17 illustrates the challenges of developing highly selective ligands. Despite being designed as an NMUR2 agonist, this compound unexpectedly showed antagonistic activity at multiple receptors including NPBWR1, OPRM1, and PRLHR . This promiscuity highlights the need for comprehensive counter-screening against related receptors during drug development.

Despite these challenges, the relatively recent evolutionary emergence of NPBWR2 in primates suggests it may have specialized functions that could provide unique therapeutic opportunities less prone to side effects compared to more evolutionarily conserved systems. Understanding these primate-specific functions will be crucial for identifying the most promising therapeutic applications.

What lessons can be learned from related neuropeptide receptor drug discovery efforts?

Drug discovery efforts targeting related neuropeptide receptors provide valuable lessons for NPBWR2 research. The development of NPY receptor modulators offers particularly relevant insights, as these receptors share functional similarities with the NPB/NPW system in regulating energy homeostasis .

The table below summarizes key lessons from NPY receptor drug discovery:

CompoundReceptor TargetClinical StageOutcomeLesson for NPBWR2 Research
ObinepitideY2R/Y4R agonistPhase I/IISide effects (nausea)Consider broad physiological impacts
MK-0557Y5R antagonistClinical trialsLimited efficacyValidate target thoroughly before clinical development
VelneperitY5R antagonistClinical trialsFailed to achieve meaningful weight reductionUnderstand complete signaling network

These experiences emphasize several critical considerations for NPBWR2 drug discovery: (1) the importance of developing highly selective compounds, (2) the need to comprehensively understand physiological roles before clinical development, and (3) the value of identifying biomarkers that can predict efficacy and side effects early in development.

The observation that NPY receptor knockout mice show relatively subtle phenotypes suggests that antagonists may have limited efficacy while agonists might produce more robust physiological effects. This pattern may apply to NPBWR2 as well and should inform decisions about therapeutic strategies.

How can CRISPR/Cas9 technology advance NPBWR2 research?

CRISPR/Cas9 genome editing offers transformative approaches for studying NPBWR2 function, particularly given the challenges associated with its primate-specific expression. This technology enables precise genetic manipulation that can overcome traditional limitations in NPBWR2 research.

For cellular studies, CRISPR/Cas9 can be used to:

  • Generate knockout cell lines by introducing frameshift mutations in the NPBWR2 gene, allowing assessment of receptor-dependent signaling and phenotypes

  • Create knock-in cell lines expressing tagged versions of NPBWR2 (such as GFP or luciferase fusions) to monitor receptor localization, trafficking, and activity in real-time

  • Introduce specific point mutations to study structure-function relationships and evaluate the impact of naturally occurring polymorphisms

  • Modify regulatory regions to investigate transcriptional control of NPBWR2 expression

Perhaps most significantly, CRISPR/Cas9 technology enables the development of humanized mouse models expressing human NPBWR2. These models could overcome the species barrier that has hampered in vivo research on this receptor. Strategies include replacing mouse Npbwr1 with human NPBWR2 under the control of the endogenous promoter or introducing human NPBWR2 as a transgene under the control of cell type-specific promoters.

When designing CRISPR experiments, researchers should carefully consider guide RNA selection to minimize off-target effects, employ appropriate validation strategies to confirm the intended genetic modifications, and include comprehensive controls to ensure observed phenotypes are specifically related to NPBWR2 manipulation.

What omics approaches can provide insights into NPBWR2 biology?

Multi-omics approaches offer powerful strategies to comprehensively characterize NPBWR2 biology across molecular, cellular, and systems levels. These approaches are particularly valuable for generating hypotheses about receptor function and identifying novel interaction partners and signaling pathways.

Transcriptomic analyses using RNA sequencing can identify genes and pathways regulated by NPBWR2 activation. By comparing gene expression profiles in control versus NPBWR2-activated conditions, researchers can map downstream signaling networks and biological processes influenced by this receptor. Single-cell RNA sequencing provides additional resolution by identifying cell type-specific responses and heterogeneity in NPBWR2 expression patterns.

Proteomic approaches such as mass spectrometry-based techniques can identify proteins that interact with NPBWR2, either directly or as components of signaling complexes. Proximity labeling methods like BioID or APEX can capture transient interactions in living cells, providing a more comprehensive view of the receptor's interactome.

Metabolomic analyses can reveal metabolic pathways affected by NPBWR2 signaling, which is particularly relevant given its potential role in energy homeostasis. By measuring changes in metabolite levels in response to receptor activation or inhibition, researchers can identify metabolic signatures associated with NPBWR2 function.

Integration of multi-omics data using systems biology approaches can provide holistic insights into NPBWR2 biology. Network analysis and pathway enrichment can identify biological processes and regulatory mechanisms affected by NPBWR2, generating testable hypotheses about its physiological functions.

How can structural biology approaches enhance understanding of NPBWR2 function?

Structural biology approaches provide critical insights into the molecular mechanisms of NPBWR2 function, facilitating rational drug design and mechanistic understanding of receptor activation and regulation. While no high-resolution structure of NPBWR2 has been published to date, several complementary approaches can advance structural understanding of this receptor.

Homology modeling based on crystal structures of related GPCRs provides a starting point for understanding NPBWR2 structure. The structural similarities with opioid receptors make them particularly valuable templates. These models can predict the three-dimensional arrangement of transmembrane helices, ligand binding pocket architecture, and potential sites for allosteric modulation.

Site-directed mutagenesis guided by structural models can identify residues critical for ligand binding and receptor activation. By systematically mutating predicted binding site residues and measuring effects on ligand affinity and receptor signaling, researchers can refine structural models and identify key molecular determinants of receptor function.

Advanced biophysical techniques provide direct structural information. Cryo-electron microscopy (cryo-EM) has revolutionized GPCR structural biology, enabling determination of near-atomic resolution structures of receptors in multiple conformational states. Applying this approach to NPBWR2, particularly in complex with different ligands, could reveal the molecular basis of receptor activation and ligand selectivity.

Hydrogen-deuterium exchange mass spectrometry (HDX-MS) offers complementary structural information by measuring solvent accessibility and conformational dynamics. This approach can identify regions of NPBWR2 that undergo conformational changes upon ligand binding or during signaling events, providing insights into the molecular mechanisms of receptor function.

What are the most pressing unanswered questions in NPBWR2 research?

Despite progress in understanding the NPB/NPW system, numerous critical questions about NPBWR2 remain unanswered. Perhaps most fundamental is the question of why NPBWR2 evolved specifically in primates and what specialized functions it might serve that are not fulfilled by NPBWR1. This evolutionary divergence suggests NPBWR2 may have roles particularly relevant to primate physiology or behavior that warrant further investigation.

The precise physiological roles of NPBWR2 in humans remain largely unknown. While the NPB/NPW system has been implicated in energy homeostasis, pain modulation, and stress responses , the specific contributions of NPBWR2 to these processes versus those of NPBWR1 require clarification. Understanding these functions is essential for identifying potential therapeutic applications and predicting possible side effects of NPBWR2-targeted interventions.

From a pharmacological perspective, critical questions include whether truly selective agonists and antagonists for NPBWR2 versus NPBWR1 can be developed, and whether such compounds would have therapeutic utility. The observation that compound 17 shows unexpected cross-reactivity across multiple receptor systems highlights the challenges in developing selective ligands but also suggests opportunities for identifying novel chemical scaffolds with activity at NPBWR2.

Methodologically, developing appropriate experimental systems to study NPBWR2 function remains challenging. Creating humanized animal models or advanced in vitro systems that accurately recapitulate human NPBWR2 biology will be crucial for advancing understanding of this receptor's functions and therapeutic potential.

How might collaborative approaches accelerate progress in the NPBWR2 field?

The multifaceted challenges in NPBWR2 research necessitate collaborative approaches that integrate expertise across disciplines. Consortia bringing together structural biologists, medicinal chemists, molecular pharmacologists, physiologists, and clinicians could accelerate progress in understanding NPBWR2 biology and developing therapeutic applications.

Open science initiatives sharing resources such as validated antibodies, cell lines, and compounds would address critical needs in the field. Particularly valuable would be the establishment of a repository of well-characterized NPBWR2 ligands with documented selectivity profiles, enabling researchers to conduct comparable studies across different laboratories.

Public-private partnerships could accelerate drug discovery efforts by combining the innovation of academic research with the development capabilities of pharmaceutical companies. Such collaborations could focus on developing selective NPBWR2 modulators as both research tools and potential therapeutics, overcoming the current limitation of available compounds.

Technology sharing platforms focusing on methodological advances, such as improved expression systems for recombinant NPBWR2 or optimized functional assays, would benefit the broader research community. Regular symposia or workshops dedicated to NPB/NPW receptor biology would facilitate knowledge exchange and foster new collaborations.

These collaborative approaches would be particularly valuable given the relatively small size of the NPBWR2 research community compared to fields focused on more extensively studied receptors, allowing more efficient use of limited resources and accelerating scientific progress.

What translational opportunities might emerge from advanced NPBWR2 research?

As understanding of NPBWR2 biology advances, several promising translational opportunities may emerge. The receptor's potential roles in energy homeostasis suggest applications in metabolic disorders such as obesity or diabetes. Unlike NPY receptor modulators that have shown limited clinical success , NPBWR2-targeted therapies might offer novel mechanisms with potentially different efficacy and side effect profiles.

The involvement of the NPB/NPW system in pain modulation suggests potential applications in pain management. Given the current opioid crisis, non-opioid analgesics represent a critical unmet medical need. If NPBWR2 modulators can affect pain perception through mechanisms distinct from opioid receptors, they might offer analgesic benefits without the risks of addiction and respiratory depression associated with opioids.

The primate-specific expression of NPBWR2 suggests it may have evolved to serve specialized functions in human physiology or behavior. Understanding these functions could reveal unexpected therapeutic applications in neuropsychiatric conditions or stress-related disorders that particularly affect humans.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.