Recombinant Human Ninjurin-2 (NINJ2)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Human Ninjurin-2 (NINJ2)

Recombinant Human Ninjurin-2 (NINJ2) is a cell adhesion molecule that has been studied for its roles in various biological processes, including cell-to-cell interactions, neural development, and cancer progression. NINJ2 is a homophilic adhesion molecule, meaning it interacts with itself on adjacent cells, and it is distinct from its homolog, Ninjurin-1, in terms of its adhesion motifs and cellular interactions .

Biological Functions of NINJ2

NINJ2 plays significant roles in the peripheral nervous system, where it is constitutively expressed in mature sensory and enteric neurons. It promotes neurite outgrowth from dorsal root ganglion neurons through homophilic interactions . Additionally, NINJ2 is involved in hematopoietic and lymphatic tissues, suggesting a broader role in cellular interactions beyond the nervous system .

Role in Cancer

Recent studies have highlighted NINJ2's involvement in cancer, particularly in colorectal cancer (CRC). Overexpression of NINJ2 in CRC cells enhances cell proliferation and survival by interacting with receptor tyrosine kinases (RTKs) such as EGFR, PDGFRα/β, and FGFR. This interaction leads to the activation of downstream signaling pathways like Akt and Erk, which are crucial for cell growth and survival .

Cancer-Related Functions:

FunctionDescription
Cell ProliferationOverexpression of NINJ2 promotes CRC cell proliferation.
RTK InteractionInteracts with RTKs to activate downstream signaling pathways (Akt and Erk).
Survival EnhancementEnhances CRC cell survival by modulating RTK signaling.

Interaction with p53

NINJ2 is also linked to the tumor suppressor p53. It can be induced by p53 and, in turn, modulates p53 expression by repressing its mRNA translation. This feedback loop results in NINJ2 exerting opposing effects on cell growth depending on the p53 status: inhibiting growth in wild-type p53 cells and promoting growth in mutant p53 cells .

Recombinant Protein Applications

Recombinant Human Ninjurin-2 protein is used in various research applications, including blocking assays. These proteins are often expressed in E. coli and are validated for use in studying cell adhesion and signaling pathways .

Recombinant Protein Applications:

ApplicationDescription
Blocking AssaysUsed to study cell adhesion and signaling pathways.
Expression SystemTypically expressed in E. coli.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline for customers.
Shelf Life
Shelf life depends on various factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
NINJ2; Ninjurin-2; Nerve injury-induced protein 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-142
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
NINJ2
Target Protein Sequence
MESARENIDLQPGSSDPRSQPINLNHYATKKSVAESMLDVALFMSNAMRLKAVLEQGPSS HYYTTLVTLISLSLLLQVVIGVLLVVIARLNLNEVEKQWRLNQLNNAATILVFFTVVINV FITAFGAHKTGFLAARASRNPL
Uniprot No.

Target Background

Function

Recombinant Human Ninjurin-2 (NINJ2) is a homophilic cell adhesion molecule that promotes axonal growth. It may play a significant role in nerve regeneration and the development and function of various tissues.

Gene References Into Functions

NINJ2's Role in Disease: Research Findings

  1. Ninjurin-2 regulates endothelial inflammation and activation via TLR4 signaling pathways, offering insights into its involvement in atherosclerosis. PMID: 28431986
  2. Increased NINJ2 mRNA expression is associated with the rs3809263 G>A polymorphism, suggesting it's a functional SNP and biomarker for large artery atherosclerotic stroke risk. PMID: 26687183
  3. Common and rare NINJ2 variants show nominal association with ischemic stroke. PMID: 24959832
  4. Ischemic stroke risk is elevated in rs11833579 AA genotype carriers who smoke. PMID: 24664524
  5. The rs11833579 A/A or G/A genotype may influence the onset age of ischemic stroke without affecting silent cerebrovascular lesions. PMID: 22429733
  6. Meta-analysis suggests that rs12425791 is associated with ischemic stroke risk under a dominant model in Asian populations, but not rs11833579. PMID: 22795341
  7. Meta-analysis reveals a significant association between NINJ2 SNP rs12425791 and ischemic stroke in East Asian (excluding Chinese Han) populations, with A alleles increasing risk. PMID: 22297388
  8. The genetic variant rs10849373 within NINJ2 is associated with ischemic stroke risk in Chinese Han subjects. PMID: 21722921
  9. NINJ2 SNPs rs11833579 and rs12425791 show no association with ischemic stroke in the Chinese Han population. PMID: 21376321
  10. NINJ2 polymorphisms are associated with Alzheimer's disease risk. PMID: 21674003
  11. A significant association exists between the rs11833579 polymorphism in NINJ2 and stroke risk in Han Chinese. PMID: 20957003
Database Links

HGNC: 7825

OMIM: 607297

KEGG: hsa:4815

STRING: 9606.ENSP00000307552

UniGene: Hs.655804

Protein Families
Ninjurin family
Subcellular Location
Membrane; Multi-pass membrane protein.
Tissue Specificity
Widely expressed. In adult, higher expression in the bone marrow and peripheral blood lymphocytes, medium in the lung, lymph node, thyroid, uterus, thymus, spleen, prostate and skeletal muscle, lower in the liver, placenta, brain, heart and kidney. In emb

Q&A

What is the structure and membrane topology of human Ninjurin-2?

Ninjurin-2 (NINJ2) is a 142 amino acid homophilic cell adhesion molecule with an unusual membrane orientation. It consists of a 65 amino acid N-terminal extracellular domain (ECD) (aa 1-65) containing a phosphorylation site at Ser3, followed by a first transmembrane segment, a cytoplasmic region, a second transmembrane segment, and a C-terminal extracellular domain (aa 128-142) . Unlike many other membrane proteins, NINJ2 does not contain N-linked glycosylation sites or a signal sequence . The transmembrane domains represent the most highly conserved regions between NINJ1 and NINJ2 . The NINJ2 gene is located on human chromosome 12p13 and contains three introns, with the intron locations precisely conserved between NINJ1 and NINJ2 .

How does NINJ2 compare structurally and functionally with its paralog NINJ1?

While NINJ2 shares 55% protein identity with human NINJ1, there are critical structural and functional differences:

  • NINJ2 (142 aa) is shorter than NINJ1 (152 aa) with a major insertion near the N-terminus in NINJ1

  • NINJ2 lacks the homophilic adhesive motif present in residues 26-37 of NINJ1

  • Both proteins can assemble into linear filaments that bind strongly to lipids, but NINJ2 filaments have an intrinsic curvature, while NINJ1 filaments are straighter

  • The root mean square deviation (RMSD) for the 101 pairs of C-alpha atoms between NINJ1 and NINJ2 is measured to be 0.792 Å, indicating high structural similarity of individual subunits

  • Despite their similarities, NINJ1 and NINJ2 do not interact with each other (they engage in homophilic but not heterophilic interactions)

  • NINJ1 can mediate plasma membrane rupture (PMR), while NINJ2 cannot due to its intrinsic filament curvature

What is the tissue distribution and expression pattern of NINJ2?

NINJ2 shows a distinct tissue-specific expression pattern:

  • Highest expression in bone marrow, followed by peripheral leukocytes, lung, and lymph nodes

  • In the peripheral nervous system, NINJ2 is constitutively expressed in mature sensory and enteric neurons but not in glial cells or in autonomic ganglia

  • In the central nervous system, NINJ2 is expressed in radial glial cells but not in neurons

  • In the kidney, NINJ2 is specifically detected in the glomeruli

  • NINJ2 expression is dramatically elevated in differentiated postmitotic neurons during development

  • Unlike NINJ1, which is ubiquitously expressed in epithelial tissues such as breast, liver, and spleen, NINJ2 is predominantly expressed in hematopoietic and lymphatic tissues

What are the key biological functions of NINJ2?

NINJ2 serves several important biological roles:

  • Cell adhesion: Functions as a homophilic adhesion molecule mediating cell-to-cell interactions through its extracellular domains

  • Nerve regeneration: Upregulated in Schwann cells surrounding the distal segment of injured nerves with a time course similar to that of NINJ1, neural CAM, and L1

  • Neurite outgrowth: Promotes neurite outgrowth from primary cultured dorsal root ganglion neurons, presumably via homophilic cellular interactions

  • p53 regulation: Forms a feedback loop with p53 where NINJ2 is induced by p53 and in turn regulates p53 expression via mRNA translation

  • Inflammation: In endothelial cells, NINJ2 activates the TLR4 signaling pathway and promotes inflammation

How is NINJ2 implicated in cardiovascular diseases?

Multiple studies have identified associations between NINJ2 polymorphisms and cardiovascular diseases:

  • Coronary Heart Disease (CHD):

    • A case-control study with 499 CHD cases and 505 controls found that rs118050317 significantly increased CHD risk in people aged more than 60 years and in women

    • rs118050317 and rs7307242 showed strong relationships with hypertension risk in CHD patients

    • rs75750647 increased diabetes risk in CHD patients under multiple genetic models, while rs10849390 exhibited protective effects against diabetes in CHD patients

  • Stroke:

    • Multiple studies have linked NINJ2 gene polymorphisms with ischemic stroke risk

    • In endothelial cells, NINJ2 activates the TLR4 signaling pathway and promotes inflammation, potentially contributing to vascular pathology

  • Other vascular conditions:

    • The NINJ2 gene is located on human chromosome 12p13, a region linked to several disorders including inflammatory bowel disease and acrocallosal syndrome

    • Protein-protein interaction network and functional enrichment analyses suggest NINJ2 plays a significant role in the pathogenesis and progression of CHD

What is the role of NINJ2 in p53-dependent growth regulation?

NINJ2 participates in a complex feedback loop with p53 that has context-dependent effects:

  • NINJ2 induction by p53:

    • NINJ2 is induced by DNA damage in a p53-dependent manner

    • p53 directly binds to a p53-responsive element in the NINJ2 promoter, with binding increased following treatment with doxorubicin

  • Regulation of p53 by NINJ2:

    • NINJ2 regulates p53 expression via mRNA translation

    • Loss of NINJ2 promotes p53 expression via enhanced mRNA translation

  • Opposing effects based on p53 status:

    • In wild-type p53-expressing cells (MCF7, Molt4):

      • Loss of NINJ2 inhibits cell growth and leads to growth suppression

      • NINJ2 deficiency causes premature senescence in mouse embryo fibroblasts (MEFs) in a wild-type p53-dependent manner

    • In mutant p53-expressing cells (MIA-PaCa2):

      • Loss of NINJ2 promotes cell growth and migration

This differential effect based on p53 status suggests that NINJ2 could potentially be a therapeutic target, with effects dependent on the p53 status of the target tissue .

What are the recommended methods for reconstituting and handling recombinant NINJ2?

Based on commercial recombinant NINJ2 protein information:

Reconstitution:

  • Recombinant Human NINJ2 (Met1-Thr65, with a C-terminal 6-His tag) is typically provided as a lyophilized preparation from a 0.2 μm filtered solution in PBS

  • It should be reconstituted at a concentration of 250 μg/mL in PBS

Storage:

  • Use a manual defrost freezer and avoid repeated freeze-thaw cycles

  • The product is shipped at ambient temperature but should be stored immediately at the recommended temperature upon receipt

Carrier considerations:

  • Recombinant NINJ2 is available with or without a carrier protein (typically Bovine Serum Albumin, BSA)

  • Adding a carrier protein enhances protein stability, increases shelf-life, and allows storage at more dilute concentrations

  • For cell or tissue culture applications or as an ELISA standard, the version with BSA is generally advisable

  • For applications where BSA could interfere, the carrier-free version is recommended

What experimental models are suitable for studying NINJ2 function?

Several experimental models have been successfully used to study NINJ2:

  • Cell culture models:

    • Wild-type p53-containing cell lines: MCF7 (human breast cancer) and Molt4 (human T lymphoblast)

    • Mutant p53-containing cell lines: MIA-PaCa2

    • Jurkat cells for adhesion assays

    • Mouse embryo fibroblasts (MEFs) for studying premature senescence

  • Genetic manipulation approaches:

    • siRNA-mediated knockdown of NINJ2

    • p53-knockout cell lines for studying p53-dependent aspects of NINJ2 function

    • Comparison studies between NINJ1 and NINJ2 expression systems

  • Structural analysis methods:

    • CryoEM for studying NINJ2 filament formation and lipid interactions

    • Negative-staining EM for visualization of protein assemblies

  • Functional assays:

    • Colony formation assays to assess cell growth effects

    • ChIP assays to study p53 binding to the NINJ2 promoter

    • Neurite outgrowth assays with primary cultured dorsal root ganglion neurons

    • Cell adhesion assays using homophilic binding properties

What is the molecular mechanism behind NINJ2's inability to mediate plasma membrane rupture compared to NINJ1?

The differential ability to mediate plasma membrane rupture (PMR) between NINJ1 and NINJ2 has been elucidated through structural biology:

  • Filament structure differences:

    • Both NINJ1 and NINJ2 assemble into linear filaments that bind strongly to lipids on one side but are water-soluble on the other side

    • NINJ1 filaments are relatively straight, allowing them to wrap around membrane blebs

    • NINJ2 filaments have an intrinsic curvature, forming a spring-shaped assembly with a diameter of approximately 45 nm

    • This fixed curvature prevents NINJ2 from properly wrapping around membrane blebs to induce PMR

  • Lipid binding differences:

    • NINJ2 binds more strongly to cholesterol at the inner leaflet of the lipid bilayer, which is responsible for the curving of the NINJ2 filament

    • NINJ1 has stronger lipid binding at the outer leaflet, contributing to its capability of mediating PMR

    • The NINJ1 filament appears slightly skinnier than the NINJ2 filament, as if one central layer of lipids present in the NINJ2 filament were missing in the NINJ1 filament

    • Inner leaflet lipid densities in NINJ1 appear to be more discrete compared to those in NINJ2

  • Experimental evidence:

    • Membrane bleb-like particles can be directly observed in negative-staining EM images of purified NINJ1 samples but not in NINJ2 samples

    • Single-layer NINJ1 filaments exhibit considerable lateral flexibility, enabling them to wrap around membrane blebs, whereas the vertical flexibility of both filaments is very limited

How can researchers investigate the homophilic binding mechanisms of NINJ2?

To study NINJ2's homophilic binding properties, researchers can employ several approaches:

  • Cell aggregation assays:

    • Express NINJ2 in cell lines like Jurkat cells that normally don't aggregate

    • Mix differentially labeled cells (e.g., red and green fluorescent dyes) to observe homophilic binding

    • Quantify the number of cells in each aggregate to measure binding strength

    • Compare with NINJ1-expressing cells and test for heterophilic interactions by mixing NINJ1 and NINJ2 expressing cells

  • Structure-function analysis:

    • Generate truncated versions of NINJ2 to identify critical domains for homophilic binding

    • Create chimeric proteins between NINJ1 and NINJ2 to determine which regions confer specific binding properties

    • Perform site-directed mutagenesis of conserved residues to identify amino acids critical for binding

  • Biophysical techniques:

    • Surface plasmon resonance to measure binding kinetics

    • Atomic force microscopy to visualize and quantify binding strength

    • Förster resonance energy transfer (FRET) to detect protein-protein interactions

  • Functional assays:

    • Neurite outgrowth assays with primary cultured dorsal root ganglion neurons to assess the functional consequences of homophilic binding

    • Wound healing assays to evaluate how NINJ2-mediated adhesion affects cell migration

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.