Recombinant Human NKG2-F type II integral membrane protein (KLRC4)

What is the genomic organization of the KLRC4 gene and how is it positioned within the NK gene complex?

The KLRC4 gene is located on chromosome 12p13.2 within the Natural Killer gene Complex (NKC), a region spanning approximately 2 Mbp that contains several C-type lectin genes preferentially expressed in NK cells. The gene spans positions 10407384 to 10409757 on chromosome 12 (complement strand) and consists of 4 exons . KLRC4 is situated in close proximity to other NKG2 family genes, with a notable feature being the read-through transcription that exists between KLRC4 and the downstream KLRK1 (killer cell lectin-like receptor subfamily K, member 1) gene . This genomic arrangement likely facilitates coordinated regulation of these functionally related immune receptors.

How does NKG2F structurally compare to other members of the NKG2 receptor family?

NKG2F (KLRC4) is a C-type lectin, type II transmembrane molecule characteristic of the NKG2 family. Its protein sequence includes:

The full amino acid sequence (AA 1-158) is: MNKQRGTYSEVSLAQDPKRQQRKLKGNKISISGTKQEIFQVELNLQNASSDHQGNDKTYHCKGLLPPPEKLTAEVLGIICIVLMATVLKTIVLIPCIGVLEQNNFSLNRRMQKARHCGHCPEEWITYSNSCYYIGKERRTWEERVPWPVLRRTLICFL .

Unlike the inhibitory NKG2A receptor which contains immunoreceptor tyrosine-based inhibitory motifs (ITIMs), NKG2F appears to have an activating function through DAP12 association , aligning its signaling mechanism more closely with activating NKG2 family members.

What is currently known about NKG2F's function in NK cell activation and immune responses?

NKG2F is expressed on the surface of human blood NK cells and appears to play a role in NK cell activation. Current evidence suggests:

• NKG2F may associate with DAP12 to activate NK cells, indicating an activating receptor function

• Expression is upregulated at both mRNA and protein levels after IL-2 or IL-15 stimulation, suggesting involvement in cytokine-mediated NK cell activation

• As part of the NKG2 family, it likely contributes to NK cell functions against tumor cells and virus-infected cells

• Its expression is specifically regulated, as it was detected in peripheral blood mononuclear cells (PBMCs) but not in human NK cell lines such as NKL and YT at the mRNA level

While specific ligands for NKG2F are not definitively established in the literature, it may recognize MHC class I HLA-E molecules similar to other NKG2 family members . Further research is needed to fully characterize its precise role in immune surveillance and response mechanisms.

How is NKG2F expression regulated at the transcriptional and post-transcriptional levels?

The regulation of NKG2F expression involves several mechanisms:

• Cytokine-mediated regulation: IL-2 and IL-15 stimulation can upregulate NKG2F at both mRNA and protein levels in human blood NK cells . These cytokines are known to activate NK cells and promote their proliferation and cytotoxic function.

• Cell type-specific expression: NKG2F was found to be expressed only by PBMCs but not by human NK cell lines such as NKL and YT at the mRNA level , suggesting cell-specific transcriptional control mechanisms.

• Potential signaling pathways: As a member of the NKG2 family, its expression might be regulated through pathways similar to other family members. For comparison, NKG2D expression is modulated by various cytokines, with IL-2, IL-7, IL-12, and IL-15 upregulating expression, while TGFβ, interferon-β1, and IL-21 downmodulate expression .

• Genetic factors: Polymorphisms in KLR family genes have been associated with receptor expression levels , suggesting genetic determinants may also influence NKG2F expression.

The specific transcription factors and detailed molecular mechanisms controlling NKG2F expression remain areas requiring further investigation.

What experimental approaches can be used to study NKG2F expression in different immune cell subsets?

Several complementary approaches can be used to comprehensively analyze NKG2F expression:

For NKG2F specifically, researchers have successfully employed:

• RT-PCR to detect mRNA expression in different cell types

• Western blotting with polyclonal antibodies generated against recombinant NKG2F

• Flow cytometry to measure surface expression on NK cells

When selecting antibodies, validated options include polyclonal antibodies produced by immunizing BALB/c mice with recombinant NKG2F and monoclonal Anti-KLRC4 antibody (clone 1D10) for ELISA and western blot applications .

How might viral infections modulate NKG2F expression, and what are the functional consequences?

While direct evidence for how viral infections specifically affect NKG2F expression is limited in the literature, several insights can be drawn from studies of related NKG2 family receptors:

• Human cytomegalovirus (HCMV) specifically triggers differentiation and expansion of NK cells expressing high levels of NKG2C , suggesting viruses can selectively influence NKG2 receptor expression patterns.

• Viruses have developed numerous strategies to evade detection by the NKG2D surveillance system , indicating evolutionary pressure on this receptor family, which likely extends to NKG2F.

• The NKG2 family plays important roles in the regulation of NK cell functions against virus-infected cells , suggesting NKG2F may participate in antiviral immunity.

Potential functional consequences of virus-induced changes in NKG2F expression might include:

• Altered NK cell activation thresholds

• Modified cytotoxic responses against infected cells

• Changes in cytokine production profiles

• Contribution to memory-like NK cell formation

Research specifically addressing how different viruses affect NKG2F expression and function would significantly advance our understanding of this receptor's role in antiviral immunity.

What are the optimal approaches for producing recombinant human NKG2F protein for research applications?

Multiple expression systems have been successfully used to produce recombinant NKG2F, each with distinct advantages:

Bacterial Expression System (E. coli):

• Implementation: Using pET-28a vector with a hexahistidine (6x His) tag and a thrombin digestion sequence at the N-terminus

• Induction: IPTG (isopropyl-beta-d-thio-galactoside) induction results in high expression levels

• Purification: Affinity chromatography using the His-tag

• Validation: Anti-His western blotting and LC-MS/MS for confirmation

• Advantages: High yield, cost-effective, suitable for structural studies

• Limitations: Lacks mammalian post-translational modifications

Mammalian Expression System:

• Implementation: Expression in HEK-293 cells with appropriate tag (e.g., His tag)

• Purification: One-step purification using tag-based affinity chromatography

• Advantages: Proper protein folding, post-translational modifications

• Applications: Functional studies requiring physiologically relevant protein conformation

Choosing an Expression System:
The optimal approach depends on the intended application:

• For structural studies or antibody generation: bacterial expression may be sufficient

• For functional assays or studies of protein-protein interactions: mammalian expression provides more native-like protein

For glycosylation analysis or therapeutic development, insect cell or CHO cell expression systems might offer additional advantages not discussed in the available literature on NKG2F.

What techniques can be used to evaluate NKG2F-mediated signaling in NK cells?

Investigating NKG2F-mediated signaling requires a multi-faceted approach:

• Biochemical analysis of signaling complexes:

  • Immunoprecipitation to identify NKG2F-associated proteins (e.g., DAP12)

  • Western blotting to detect phosphorylation of signaling molecules

  • Mass spectrometry to identify novel interaction partners

• Functional readouts of NK activation:

  • Cytotoxicity assays (Cr51-release or flow cytometry-based)

  • Cytokine production (ELISA, intracellular cytokine staining, or Luminex)

  • Degranulation assays (CD107a surface expression)

  • Calcium flux measurements

• Genetic manipulation approaches:

  • CRISPR-Cas9 gene editing to knockout KLRC4

  • Overexpression systems using lentiviral vectors

  • Mutation of specific signaling motifs

  • Knockdown using siRNA or shRNA technology

• Imaging techniques:

  • Confocal microscopy to visualize receptor clustering

  • Live cell imaging to track signaling dynamics

  • Proximity ligation assays to detect protein-protein interactions

For NKG2F specifically, studying its association with DAP12 is critical since this adapter protein contains immunoreceptor tyrosine-based activation motifs (ITAMs) that initiate downstream signaling cascades . When developing these assays, comparing NKG2F signaling with better-characterized NKG2 family members can provide valuable context.

What are the advantages and limitations of different antibodies available for NKG2F detection?

Several antibodies are available for NKG2F/KLRC4 detection, each with specific characteristics:

Selection considerations:

• Application compatibility: Ensure the antibody has been validated for your specific application (western blot, flow cytometry, immunoprecipitation, etc.)

• Epitope location: For membrane proteins like NKG2F, antibodies recognizing extracellular domains are required for flow cytometry of live cells

• Validation status: Look for antibodies with published validation, especially showing specificity with appropriate positive and negative controls

• Clone selection: For monoclonal antibodies, different clones may recognize different epitopes with varying accessibility in different applications

When detecting NKG2F by flow cytometry, careful optimization of staining protocols is recommended given its potentially low expression levels on some cell populations.

Is there evidence linking NKG2F/KLRC4 to autoimmune or inflammatory diseases?

Available evidence suggests potential connections between KLRC4 and certain autoimmune conditions:

• Behçet's disease association: KLRC4 has been identified in genome-wide association studies related to Behçet's disease . Deep exonic resequencing studies included KLRC4 among genes evaluated for association with this inflammatory condition , though specific results for KLRC4 weren't detailed in the search results.

• Genetic basis: The study by Kirino et al. examined nonsynonymous variants (NSVs) in several genes, including KLRC4, to evaluate their collective association with Behçet's disease . This approach recognized that rare and low-frequency variants in genes like KLRC4 might contribute to disease pathogenesis.

• Context within NK receptor genetics: Polymorphisms in KLR family genes have been associated with receptor expression levels and NK cell function , suggesting genetic variation in KLRC4 might influence inflammatory responses through altered NK cell activity.

• Comparison with other NK receptors: Other NK cell receptors have established roles in autoimmunity. For example, NKG2D has been implicated in several autoimmune conditions, with blockade of this pathway being considered as a therapeutic strategy .

The limited information available points to potential involvement of KLRC4/NKG2F in inflammatory pathologies, but detailed mechanistic studies are needed to establish definitive connections and functional relevance.

How might NKG2F contribute to viral immune evasion mechanisms?

While the search results don't provide direct evidence about NKG2F-specific viral evasion mechanisms, insights can be drawn from broader patterns of virus-NK receptor interactions:

• Evolutionary pressure: Viruses have developed numerous strategies to evade detection by NK receptors, particularly the NKG2D surveillance system . The diversification of NKG2 ligand genes has likely been driven by selective pressures imposed by pathogens , suggesting NKG2F may be subject to similar evolutionary dynamics.

• Cytomegalovirus as a model: Human cytomegalovirus (HCMV) specifically triggers differentiation and expansion of NK cells expressing high NKG2C levels , demonstrating virus-specific modulation of NKG2 family receptors. Similar interactions might exist between viruses and NKG2F expression.

• Potential evasion strategies: Based on known viral evasion mechanisms targeting other NK receptors, several strategies might affect NKG2F:

  • Downregulation of NKG2F ligands on infected cells

  • Expression of viral decoy proteins that bind NKG2F

  • Interference with NKG2F-associated signaling pathways

  • Modulation of NKG2F expression on NK cells

• Read-through transcription relevance: The natural read-through transcription between KLRC4 and KLRK1 might be a target for viral interference, potentially affecting expression of both receptors simultaneously.

Understanding how specific viruses interact with NKG2F would provide valuable insights into both viral pathogenesis and potential antiviral therapeutic strategies.

How do genetic polymorphisms in KLRC4 influence receptor expression and NK cell function?

The relationship between KLRC4 polymorphisms and functional outcomes remains an area needing further research, but several insights can be drawn from related studies:

• NKG2 family polymorphism patterns: Studies on the related NKG2C gene have identified allelic variation, including a novel allele that encodes a hybrid of the NKG2C01 and NKG2C02 primary structures . Similar polymorphism patterns might exist for KLRC4.

• Potential functional impact: Polymorphisms in KLR family genes, including KLRC1 (NKG2A), have been associated with NKG2A expression levels and NK cell function , suggesting similar relationships might exist for KLRC4:

  • Variations could affect protein stability or cell surface expression

  • Polymorphisms in signaling domains might alter downstream pathway activation

  • Variants in extracellular domains could modify ligand binding affinity

• Disease associations: KLRC4 was included among genes evaluated for Behçet's disease association through deep exonic resequencing , indicating researchers recognize potential disease relevance of KLRC4 polymorphisms.

• Gene deletion phenomenon: While not specific to KLRC4, it's notable that homo- and heterozygous complete deletions of the related KLRC2/NKG2C gene occur in up to 8% and 32% of some populations , highlighting the potential for significant structural genetic variation in this receptor family.

Comprehensive studies specifically analyzing KLRC4 polymorphisms and correlating genotypes with NK cell phenotypes and functions would significantly advance our understanding of this receptor's biology.

What is the significance of the natural read-through transcription between KLRC4 and KLRK1 genes?

The natural read-through transcription between KLRC4 and KLRK1 represents an interesting genomic feature with potential functional implications:

• Structural characteristics: This read-through transcript includes an alternate 5' exon and lacks a significant portion of the KLRC4 coding sequence, including the start codon. Consequently, it encodes the KLRK1 protein (NKG2D) rather than producing a fusion protein .

• Evolutionary significance: The preservation of this genomic arrangement suggests potential functional importance. It might represent:

  • A mechanism for coordinated regulation of these closely related immune receptors

  • An evolutionary adaptation that enhances immune system flexibility

  • A means to diversify receptor expression patterns in different cellular contexts

• Regulatory implications: The read-through transcription could provide:

  • Additional regulatory elements that influence KLRK1 expression

  • Tissue-specific or condition-specific regulation

  • Post-transcriptional control mechanisms

• Research directions: Understanding this phenomenon could be advanced through:

  • Comparative genomics across species to assess conservation

  • Analysis of read-through transcript expression in different immune cell subsets

  • Investigation of how cellular activation or disease states affect this transcription pattern

  • Functional studies using CRISPR-Cas9 to disrupt the read-through capability

This unique genomic feature highlights the complexity of gene regulation in the immune system and merits further investigation to fully understand its biological significance.

What novel therapeutic approaches might target NKG2F to modulate immune responses?

Although NKG2F-specific therapeutic strategies aren't detailed in the search results, several approaches can be envisioned based on current understanding of this receptor and related immunomodulatory strategies:

• Enhancing anti-tumor immunity:

  • Development of agonistic antibodies or small molecules targeting NKG2F to boost NK cell activation

  • Engineering chimeric antigen receptors (CARs) incorporating NKG2F signaling domains for adoptive cell therapy

  • Inducing expression of NKG2F ligands on tumor cells to enhance recognition

• Modulating NK cell expansion and function:

  • Similar to findings with NKG2A, targeting NKG2F might influence NK cell expansion capacity

  • CRISPR gene editing to modify NKG2F expression or function in therapeutic NK cells

  • Developing bispecific antibodies linking NKG2F engagement to tumor antigen recognition

• Addressing autoimmunity or inflammation:

  • If NKG2F proves to have pro-inflammatory effects, antagonistic antibodies might be beneficial in autoimmune conditions

  • Targeting the NKG2F-DAP12 interaction to modulate downstream signaling intensity

  • Small molecule inhibitors of specific NKG2F-mediated signaling pathways

• Anti-viral applications:

  • Similar to strategies with mouse CMV, introducing genes encoding NKG2F ligands into viral vectors could potentially generate effective vaccines

  • Enhancing NKG2F-mediated recognition of virus-infected cells

Any therapeutic development would require deeper understanding of:

• The specific ligands recognized by NKG2F

• The precise signaling pathways activated

• The receptor's role in different disease contexts

• Potential off-target effects of receptor modulation

As research on NKG2F advances, more targeted therapeutic approaches will likely emerge.

What are the most significant gaps in our current understanding of NKG2F biology?

Despite progress in characterizing NKG2F, several critical knowledge gaps remain:

Addressing these knowledge gaps would significantly advance our understanding of this receptor and its potential applications in immunology and medicine.

What novel experimental approaches could accelerate research on NKG2F function?

Several cutting-edge approaches could significantly advance our understanding of NKG2F:

• Single-cell multi-omics:

  • Single-cell RNA-seq combined with protein expression analysis to correlate NKG2F expression with global transcriptional states

  • Spatial transcriptomics to understand NKG2F expression in tissue contexts

  • Epigenetic profiling to identify regulatory elements controlling NKG2F expression

• Advanced genetic engineering:

  • CRISPR-Cas9 screens to identify genes regulating NKG2F expression or function

  • Domain-specific mutagenesis to map functional regions of the receptor

  • Knock-in reporter systems to track NKG2F expression dynamics in real-time

• Structural biology approaches:

  • Cryo-electron microscopy to determine NKG2F structure alone and in complex with DAP12

  • Hydrogen-deuterium exchange mass spectrometry to map protein-protein interaction surfaces

  • Molecular dynamics simulations to understand conformational changes upon activation

• Advanced imaging technologies:

  • Super-resolution microscopy to visualize NKG2F clustering and immune synapse formation

  • Intravital imaging to track NKG2F-expressing cells in vivo during immune responses

  • Förster resonance energy transfer (FRET) imaging to detect molecular interactions

• Systems immunology approaches:

  • Network analysis integrating receptor expression, signaling, and functional outcomes

  • Mathematical modeling of receptor-ligand interactions and downstream signaling dynamics

  • Multi-parameter analysis of NK cell responses correlating with NKG2F expression

• Humanized mouse models:

  • Development of models expressing human NKG2F to study its function in vivo

  • Tissue-specific or inducible expression systems to assess context-dependent roles

These approaches, particularly when combined in integrated research programs, could rapidly advance our understanding of NKG2F biology and its therapeutic potential.