Recombinant Human NTPase KAP family P-loop domain-containing protein 1 (NKPD1)

Shipped with Ice Packs
In Stock

Description

Introduction

Recombinant Human NTPase KAP Family P-Loop Domain-Containing Protein 1 (NKPD1) is a protein encoded by the NKPD1 gene in humans . NKPD1 belongs to the KAP protein family, a subgroup of P-loop NTPases. These proteins are characterized by unusual structural features, including transmembrane helices inserted into the P-loop NTPase domain . NKPD1 is predicted to be located in the membrane .

Gene Information

The human NKPD1 gene is located on chromosome 19 . It encodes a protein of 737 amino acids in length . The NKPD1 gene is also referred to as NTPase, KAP family P-loop domain containing 1 .

Protein Structure and Function

NKPD1 is a member of the P-loop NTPase superfamily. P-loop NTPases are characterized by a conserved P-loop motif involved in nucleotide binding . The NKPD1 protein contains a KAP family P-loop domain . KAP proteins possess transmembrane helices inserted within the NTPase domain, a rare feature among P-loop NTPases . These transmembrane segments likely cause NKPD1 to be an integral membrane protein, with the P-loop domain located on the intracellular side of the membrane .

Expression and Localization

NKPD1 is expressed in various human tissues .

Role in Disease

Genetic variations in NKPD1 have been associated with altered expression in the hippocampus and may affect depressive symptoms in the general population . A study has identified non-synonymous single nucleotide polymorphisms (SNPs) in NKPD1 (rs28469095) that are associated with Alzheimer's Disease and dementia .

Interactions

The polo-box domain (PBD) of Polo-like kinase 1 (Plk1) interacts with proteins and mediates Plk1 functions by targeting its N-terminal catalytic activity to subcellular structures .

Table of Key Features of NKPD1

FeatureDescription
Gene NameNKPD1 (NTPase KAP family P-loop domain containing 1)
LocationPredicted to be located in membrane
ChromosomeChromosome 19
Protein FamilyP-loop NTPase, KAP family
Structural FeaturesTransmembrane helices inserted into the P-loop NTPase domain
Associated DiseasesDepression, Alzheimer's Disease

Genetic Variants and Alzheimer's Disease

GeneSNPAlt Allele Count (aMCI)Alt Allele Count (naMCI)P ValueOR95% CI
NKPD1rs284690953950.040982.61.007-6.713

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is finalized during production. If a particular tag type is required, please inform us to prioritize its inclusion.
Synonyms
NKPD1; NTPase KAP family P-loop domain-containing protein 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-610
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
NKPD1
Target Protein Sequence
MQQEAAQRESEELQHVQWRPRAVSGWGVPQLLWYLVFLQPIITEVHLRRRNVQFLFIRFS AWQYAGTDKLWAGLVTTLCEGIRRHYGALPFSVYSVLGNKPATRQDCCQSEWHCRRRVCL GLLALLAALGLGVGLLYLSLGGHALGHGSPSGSLLKVFGGAATTLSGSGLLMAVYSVGKH LFVSQRKKIERLVSREKFGSQLGFMCEVKKEVELLTDFLCFLEIYQRRRLRVVLEVTGLD TCYPERVVGVLNAINTLLSDSHAPFIFILVVDPSILAACLESAGNMKGTADNGYLFLNRT VTLPFSVPIMGRRTKLQFLHDAVQSRDDLLYREMTRKPWLPGDAGGESAQLLAVQAQAGT ERGQGRIDDEAARRIQEALFCLHDERDCLYEYVPDNVVSMRRIVNTVPITVRLLQQQQQQ GDFGGPTPRQAVAWVVLANQWPCRLSWALQCLEDRQQTGGAPEGRARLWDVFRDNSRELH TMTKALQNVLDLDGDPELFERFLGADFPFTVAEAQSLLRCTVNLDHSIRRRMGLIRAVSA LKPPSPPKSPTRDTPHAAHRANSASRAPPSGRASGQAGEGHHTGDLAHRGKLWPVACALF RPGQSSPGGP
Uniprot No.

Target Background

Database Links

HGNC: 24739

STRING: 9606.ENSP00000321976

UniGene: Hs.299256

Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is NKPD1 and what is its predicted function?

NKPD1 (NTPase KAP family P-loop domain-containing protein 1) is a gene that encodes a protein predicted to be involved in the de novo synthesis of sphingolipids . Sphingolipids are a class of lipids that play crucial roles in cell membrane structure and signaling processes. The molecular function of NKPD1 has not been experimentally validated, as indicated by mouse gene databases that note "no experimental evidence to support Molecular Function annotation, following literature review" . Similarly, its biological process has not been experimentally confirmed, though computational predictions suggest involvement in sphingolipid metabolism. Research interest in NKPD1 has increased following genetic association studies linking it to psychiatric and neurological conditions.

How is NKPD1 linked to depressive symptoms?

Gene-based association analysis has revealed significant links between nonsynonymous variations in NKPD1 and depressive symptomatology. A pivotal study identified a robust association between NKPD1 variants and depressive symptoms (p = 3.7 × 10⁻⁰⁸) in a discovery cohort of 1,999 individuals from a genetically isolated Dutch population . The association was successfully replicated in an independent population-based cohort (n = 1,604; p = 1.5 × 10⁻⁰³), with meta-analysis strengthening the association signal (p = 1.0 × 10⁻⁰⁹) . The nonsynonymous variants in NKPD1 explained approximately 0.9% of the sex- and age-adjusted variance in depressive symptoms, which translates to 3.8% of the total estimated heritability (h² = 0.24) . These findings suggest that NKPD1 variants contribute meaningfully to depressive phenotypes despite the small absolute variance explained, making it a candidate gene for further functional studies in depression research.

What is the evidence linking NKPD1 to cognitive impairment?

Recent research has investigated the association between NKPD1 polymorphisms and amnestic mild cognitive impairment (aMCI), a condition characterized by memory impairment often accompanied by deficits in executive functioning, particularly planning abilities . A Korean cohort study examined 263 individuals with aMCI and 83 with non-amnestic MCI, analyzing genetic polymorphisms in several genes including NKPD1 . Though the detailed results for NKPD1 specifically are not fully described in the available abstract, the study framework suggests that NKPD1 variants may contribute to aMCI risk profiles. This research direction aligns with emerging understanding of shared genetic risk factors between depression and cognitive decline, particularly as NKPD1 has been implicated in both conditions.

How do NKPD1 variants compare with other genetic risk factors for neuropsychiatric traits?

In genetic association studies, NKPD1 appears to contribute meaningfully to depressive symptoms, though its effect size is modest compared to some other genetic risk factors. For instance, the APOE gene, particularly the rs429358 polymorphism, has been more strongly associated with cognitive phenotypes . Genome-wide meta-analyses have identified NKPD1 alongside other genes like LPA, APOE, and HLA-DQA1/DRB1 in studies of lifespan and related traits . When researching polygenic traits like depression or cognitive impairment, it's important to consider NKPD1 within a broader genetic context, as these conditions typically involve complex interactions among multiple genes. The identification of NKPD1 as significantly associated with depressive symptoms despite this polygenic background underscores its potential importance in mood regulation pathways.

What methods are recommended for studying NKPD1 expression?

For researchers investigating NKPD1 expression, a multi-modal approach is recommended. Quantitative PCR (qPCR) provides a reliable method for measuring mRNA expression levels across different tissues and experimental conditions. RNA sequencing can offer a more comprehensive view of expression patterns and potential splice variants. For protein-level analyses, western blotting with validated antibodies remains the gold standard, though researchers should be aware that commercial antibodies for NKPD1 may have variable specificity. Immunohistochemistry can help localize expression within tissue structures, particularly valuable for understanding NKPD1's role in complex tissues like the brain. When designing expression studies, researchers should consider the broad tissue distribution of NKPD1 observed in mouse models and prioritize tissues relevant to their hypothesized function, particularly neural tissues given its associations with neuropsychiatric phenotypes.

How can recombinant NKPD1 be produced for functional studies?

Production of recombinant human NKPD1 protein requires careful consideration of expression systems and purification strategies. Mammalian expression systems (e.g., HEK293 or CHO cells) are typically preferred for human proteins to ensure proper folding and post-translational modifications. The gene sequence should be codon-optimized for the chosen expression system and cloned into an appropriate vector with a purification tag (e.g., His-tag, GST-tag). For structural integrity, consider incorporating the complete P-loop domain, as this is likely critical for the predicted NTPase function. Purification typically involves affinity chromatography followed by size exclusion chromatography to obtain pure, homogeneous protein. Functional validation of the recombinant protein should include assays for predicted NTPase activity and sphingolipid synthesis capacity. Researchers should be prepared to optimize expression conditions extensively, as P-loop containing proteins can sometimes be challenging to express in soluble, active form.

What experimental models are most appropriate for NKPD1 functional studies?

Based on NKPD1's predicted functions and disease associations, several experimental models offer advantages for functional investigations. Cell line models including neuronal cell lines (SH-SY5Y, primary neurons) are valuable for studying NKPD1's role in cellular processes and sphingolipid metabolism. For depression-related research, both in vitro neuronal models and in vivo rodent models may be appropriate. Mouse models with NKPD1 knockout or containing human NKPD1 variants would provide valuable insights into its physiological functions and potential role in behavior and cognition. Given the association with depressive symptoms, behavioral tests assessing depression-like behaviors (forced swim test, tail suspension test) would be relevant endpoints. For cognitive studies related to amnestic mild cognitive impairment, models involving learning and memory tasks would be appropriate. When selecting experimental models, researchers should consider the multi-system expression pattern of NKPD1 and potential phenotypic effects beyond the nervous system.

How might NKPD1's role in sphingolipid synthesis connect to neuropsychiatric disorders?

NKPD1 is predicted to participate in the de novo synthesis of sphingolipids , presenting a compelling mechanistic link to neuropsychiatric conditions. Sphingolipids are crucial components of neuronal membranes and play significant roles in neurotransmission, synaptic function, and neuroinflammation. Abnormalities in sphingolipid metabolism have been implicated in various neuropsychiatric conditions, including depression and cognitive disorders. Several mechanisms might explain this connection: altered membrane fluidity affecting neurotransmitter receptor function; disrupted lipid raft composition impacting signaling pathways; aberrant sphingolipid-derived signaling molecules affecting neuronal survival or inflammatory processes; or interactions with other risk pathways such as amyloid processing in cognitive disorders. Researchers investigating NKPD1 should consider designing experiments that specifically examine sphingolipid profiles in relevant tissues and how NKPD1 variants might alter these profiles.

How do nonsynonymous variations in NKPD1 affect protein function?

Nonsynonymous variations in NKPD1 have been associated with depressive symptoms, explaining 0.9% of sex- and age-adjusted variance , but the specific functional consequences of these variants remain largely unexplored. These variations may affect protein function through several mechanisms: altered catalytic efficiency if they occur within the P-loop domain; modified protein stability or half-life; changed subcellular localization; altered interactions with protein partners or substrates; or modified regulation by post-translational modifications. Research approaches to investigate these possibilities include: in silico structural modeling to predict variant impacts on protein structure; site-directed mutagenesis to introduce specific variants into expression constructs; enzymatic assays comparing wild-type and variant proteins; and cellular studies examining localization and interaction patterns. Given NKPD1's predicted role in sphingolipid synthesis, measuring changes in sphingolipid profiles associated with different variants would provide particularly valuable insights into functional consequences.

What statistical approaches are recommended for analyzing NKPD1 genetic associations?

When analyzing NKPD1 genetic associations, researchers should employ robust statistical methodologies similar to those used in previous successful studies. Gene-based association analysis approaches are particularly valuable, as demonstrated in the study that identified NKPD1's association with depressive symptoms (p = 3.7 × 10⁻⁰⁸) . For rare variants, aggregation tests like burden tests or sequence kernel association tests (SKAT) are recommended to improve statistical power. Researchers should adjust for relevant covariates, particularly sex and age, as done in the previous NKPD1 studies . Meta-analysis techniques can help integrate findings across multiple cohorts, as illustrated by the strengthened association signal (p = 1.0 × 10⁻⁰⁹) when discovery and replication cohorts were combined . For complex phenotypes like depression or cognitive impairment, researchers should consider using validated quantitative measures rather than binary classifications to improve statistical power. Power calculations should account for the expected modest effect sizes of individual genetic variants on complex traits.

How should researchers interpret the modest effect sizes of NKPD1 variants?

The nonsynonymous variants in NKPD1 explained 0.9% of sex- and age-adjusted variance in depressive symptoms, translating to 3.8% of the total estimated heritability (h² = 0.24) . While this effect size may seem modest, it represents a meaningful contribution to a complex polygenic trait. Researchers should interpret such findings in the context of the polygenic architecture of psychiatric and neurological traits, where hundreds or thousands of variants typically contribute small effects. Even with modest effect sizes, genes like NKPD1 can provide valuable insights into biological pathways and mechanisms underlying disease. Furthermore, effect sizes in specific subpopulations or environmental contexts may be larger. When designing studies, researchers should ensure adequate sample sizes to detect such modest effects and consider pathway-based or network analyses to contextualize the role of NKPD1 within broader biological systems.

What are the key considerations for replication studies of NKPD1 findings?

Replication is essential for validating genetic associations with NKPD1. Previous successful replication of NKPD1 associations with depressive symptoms across different populations provides a methodological template. Researchers should consider several key factors when designing replication studies: using independent samples with adequate statistical power; employing comparable phenotypic assessments; accounting for population stratification and other potential confounders; and analyzing the same variants or ensuring adequate coverage of the gene. Interestingly, the replication study for NKPD1 and depression succeeded despite "little overlap with the discovery cohort in the set of nonsynonymous genetic variants observed in the NKPD1 gene" , suggesting gene-level effects rather than specific variant effects. For cognitive phenotype studies, researchers should carefully match case definitions between discovery and replication cohorts, particularly for heterogeneous conditions like mild cognitive impairment.

How might NKPD1 research inform understanding of treatment-resistant depression?

Given NKPD1's association with depressive symptoms and its predicted role in sphingolipid metabolism , this gene may offer insights into treatment-resistant depression mechanisms. Sphingolipids affect membrane properties that influence neurotransmitter receptor function and signaling, potentially modulating treatment response. Researchers could investigate whether NKPD1 variants correlate with treatment outcomes in depression cohorts, particularly examining differential responses to medications with distinct mechanisms of action. Sphingolipid-altering agents might represent novel therapeutic approaches for individuals with NKPD1 variants. Additionally, the intersection of depression and cognitive symptoms associated with NKPD1 variants suggests investigation of whether cognitive symptoms in depression correlate with treatment resistance. Methodologically, researchers could employ pharmacogenetic approaches to assess NKPD1 variant impacts on treatment outcomes and consider functional studies examining how NKPD1 variants affect cellular responses to antidepressants.

What are the implications of NKPD1 research for precision medicine in psychiatric disorders?

NKPD1 research has potential implications for precision medicine approaches in psychiatric disorders. The identification of NKPD1 variants associated with depressive symptoms and potentially with amnestic mild cognitive impairment suggests that genetic profiling could help identify specific patient subgroups. These subgroups might exhibit different symptom profiles, disease courses, or treatment responses. Researchers should investigate whether NKPD1 variants predict specific symptom clusters within depression or cognitive impairment. Metabolomic studies examining sphingolipid profiles could potentially serve as biomarkers for patients with NKPD1 variants. In the longer term, therapies targeting sphingolipid pathways might be particularly effective for individuals with specific NKPD1 genotypes. For clinical research applications, developing accessible genotyping approaches for relevant NKPD1 variants would facilitate translation to clinical settings.

What are the priority areas for advancing NKPD1 research?

Several priority areas would significantly advance understanding of NKPD1's function and clinical relevance. First, definitive experimental validation of NKPD1's biochemical function, particularly its role in sphingolipid synthesis, is essential to move beyond computational predictions . Second, comprehensive characterization of expression patterns across human tissues and developmental stages would provide context for functional studies. Third, detailed structure-function analyses of NKPD1 variants associated with depressive symptoms would elucidate the mechanistic links between genetic variation and phenotype. Fourth, expanded phenotypic studies investigating NKPD1's role in cognitive function, building on preliminary evidence from amnestic mild cognitive impairment research , would clarify its broader relevance to neuropsychiatric conditions. Fifth, investigation of potential gene-environment interactions, particularly with stress, would be relevant given NKPD1's association with depression. Finally, exploration of potential therapeutic approaches targeting NKPD1 or downstream sphingolipid pathways could translate basic findings toward clinical applications.

How might emerging technologies enhance NKPD1 research?

Emerging technologies offer promising approaches to address current gaps in NKPD1 research. CRISPR-Cas9 gene editing techniques enable precise modification of NKPD1 in cellular and animal models, allowing functional studies of specific variants identified in human populations. Single-cell sequencing approaches could reveal cell type-specific expression patterns and functional roles, particularly valuable in heterogeneous tissues like the brain. Advanced structural biology techniques, including cryo-electron microscopy, could elucidate NKPD1's three-dimensional structure and how variants affect this structure. Metabolomic approaches with improved sensitivity could better characterize changes in sphingolipid profiles associated with NKPD1 variants. Patient-derived induced pluripotent stem cells differentiated into neurons provide platforms for studying variant effects in human cellular contexts. Finally, computational approaches including machine learning may help integrate diverse data types to better understand NKPD1's role in complex biological networks and predict functional impacts of newly identified variants.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.