Recombinant Human Nuclear envelope phosphatase-regulatory subunit 1 (CNEP1R1)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Human Nuclear Envelope Phosphatase-Regulatory Subunit 1 (CNEP1R1)

Recombinant Human Nuclear Envelope Phosphatase-Regulatory Subunit 1 (CNEP1R1) is a protein that plays a crucial role in the regulation of cellular processes, particularly in the context of the endoplasmic reticulum (ER) and nuclear envelope. It acts as a regulatory subunit for the C-terminal Domain Nuclear Envelope Phosphatase 1 (CTDNEP1), enhancing its phosphatase activity and ensuring proper ER membrane morphology .

Structure and Function of CNEP1R1

CNEP1R1 is encoded by the gene located on chromosome 16 and is known to form an active complex with CTDNEP1. This complex is essential for dephosphorylating and potentially activating phosphatidate phosphatases like LPIN1 and LPIN2, which are involved in fatty acid metabolism . The interaction between CNEP1R1 and CTDNEP1 is crucial for maintaining the structural integrity of the ER and nuclear envelope.

Key Functions:

  • Regulation of ER Membrane Morphology: CNEP1R1, in conjunction with CTDNEP1, helps in restricting ER expansion, which is vital for cellular homeostasis .

  • Fatty Acid Metabolism: Indirectly modulates lipid composition by influencing the activity of phosphatidate phosphatases .

  • Protein Stability: Enhances the stability and prevents aggregation of CTDNEP1, ensuring its proper function .

Research Findings and Implications

Recent studies have elucidated the molecular mechanisms by which CNEP1R1 regulates CTDNEP1. High-resolution crystal structures of the CTDNEP1-CNEP1R1 complex have shown that CNEP1R1 acts as an allosteric activator, binding to CTDNEP1 at a site distant from its active site . This interaction not only enhances the phosphatase activity of CTDNEP1 but also stabilizes it, preventing aggregation.

Implications for Disease:

  • Cancer Association: Mutations in CTDNEP1 have been linked to medulloblastoma, suggesting that dysregulation of the CTDNEP1-CNEP1R1 complex may contribute to cancer development .

  • ER Stress: Disruption of the ER membrane morphology due to dysfunction of the CTDNEP1-CNEP1R1 complex could lead to ER stress, which is implicated in various diseases .

Predicted Functional Partners

CNEP1R1 interacts with several proteins that are involved in various cellular processes:

ProteinFunctionInteraction Score
CTDNEP1Serine/threonine protein phosphatase0.994
LPIN1Phosphatidate phosphatase involved in fatty acid metabolism0.702
LPIN2Similar to LPIN1, involved in fatty acid metabolism0.604
C16orf78Uncharacterized protein0.595
LPIN3Regulates fatty acid metabolism0.588
HEATR3HEAT repeat containing protein0.538
TENT4BTerminal nucleotidyltransferase involved in mRNA stabilization0.500
TYSND1Peroxisomal leader peptide-processing protease0.481
WACWW domain-containing adapter protein0.480
BRINP1Inhibits cell proliferation and regulates cell death0.448

These interactions highlight the role of CNEP1R1 in lipid metabolism and cellular membrane dynamics .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
CNEP1R1; C16orf69; TMEM188; Nuclear envelope phosphatase-regulatory subunit 1; NEP1-R1; Transmembrane protein 188
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-125
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
CNEP1R1
Target Protein Sequence
MNSLEQAEDLKAFERRLTEYIHCLQPATGRWRMLLIVVSVCTATGAWNWLIDPETQKVSF FTSLWNHPFFTISCITLIGLFFAGIHKRVVAPSIIAARCRTVLAEYNMSCDDTGKLILKP RPHVQ
Uniprot No.

Target Background

Function

CNEP1R1 forms an active complex with the serine/threonine protein phosphatase CTDNEP1. This complex dephosphorylates and potentially activates LPIN1 and LPIN2, phosphatidate phosphatases that catalyze the conversion of phosphatidic acid to diacylglycerol. This process regulates fatty acid metabolism at multiple levels. CNEP1R1 may indirectly modulate the lipid composition of nuclear and/or endoplasmic reticulum membranes, and is potentially required for proper nuclear membrane morphology and/or dynamics. It may also indirectly regulate lipid droplet production and triacylglycerol levels.

Gene References Into Functions
  1. The endoplasmic reticulum adaptor protein ERAdP initiates NK cell activation via the Ubc13-mediated NF-κB pathway. PMID: 25548215
  2. Nuclear envelope phosphatase 1-regulatory subunit 1 (formerly TMEM188) is the metazoan Spo7p ortholog and functions in the lipin activation pathway. PMID: 22134922
Database Links

HGNC: 26759

KEGG: hsa:255919

UniGene: Hs.59134

Protein Families
CNEP1R1 family
Subcellular Location
Nucleus membrane; Multi-pass membrane protein. Cytoplasm. Note=Filamentous pattern in the cytoplasm.
Tissue Specificity
Muscle specific with lower expression in other metabolic tissues.

Q&A

What is CNEP1R1 and what is its primary function in human cells?

CNEP1R1 (CTD nuclear envelope phosphatase 1 regulatory subunit 1) is the regulatory partner of CTDNEP1 (formerly called "dullard"). Together, they form a membrane-associated phosphatase complex primarily localized to the nuclear envelope. This complex functions as an activator of lipins, which are phosphatidic acid phosphatases involved in phospholipid metabolism. CNEP1R1 is the metazoan ortholog of yeast Spo7p and interacts with CTDNEP1 (the ortholog of yeast Nem1p) . The primary function of CNEP1R1 is to enhance CTDNEP1's ability to dephosphorylate and activate lipins, especially lipin-1 and lipin-2, which catalyze the formation of diacylglycerol from phosphatidic acid .

The CNEP1R1-CTDNEP1 complex spatially controls lipin-dependent phospholipid flux to limit phosphatidylinositol (PI) levels and restrict endoplasmic reticulum sheet formation in the vicinity of the nuclear envelope . This regulation is essential for proper nuclear envelope dynamics during cell division.

What domain architecture and protein sequence characteristics define CNEP1R1?

CNEP1R1 is a relatively small protein with key interaction domains that facilitate its binding to CTDNEP1 and localization to the nuclear envelope. The human CNEP1R1 gene encodes multiple isoforms, with the primary isoforms being nuclear envelope phosphatase-regulatory subunit 1 isoform X1 and X2 .

Sequence analysis from model organisms shows CNEP1R1 contains:

OrganismReference SequenceSequence LengthNotable Features
Pantholops hodgsoniiXP_005965611.1 (isoform X1)~126 amino acidsConserved C-terminal region
Pantholops hodgsoniiXP_005965612.1 (isoform X2)~126 amino acidsVariation in N-terminal region
Miniopterus natalensisXP_016060487.1~160 amino acidsComplete ORF sequence starting with ATGGCTGGTGCGACAGG

The protein contains conserved regions that mediate protein-protein interactions, particularly with CTDNEP1, and transmembrane domains that facilitate membrane association. The functional domains are evolutionarily conserved from yeast to humans, indicating the essential nature of this regulatory complex .

How does CNEP1R1 interact with CTDNEP1 to regulate phospholipid metabolism?

CNEP1R1 forms a complex with CTDNEP1 at the nuclear envelope, where CTDNEP1 provides the catalytic phosphatase activity while CNEP1R1 serves as the essential regulatory subunit. This interaction is crucial for CTDNEP1's ability to dephosphorylate and activate lipins . The mechanism involves:

  • CNEP1R1 stabilizes CTDNEP1, as demonstrated by increased CTDNEP1 levels in the presence of NEP1-R1 .

  • The complex specifically targets phosphorylated lipins, including lipin-1a, lipin-1b, and lipin-2, leading to their dephosphorylation .

  • Dephosphorylated lipins show increased nuclear localization and enhanced phosphatidic acid phosphatase activity .

Research has shown that CTDNEP1 can only effectively dephosphorylate lipins in human cells when CNEP1R1 is present . This functional dependency suggests that CNEP1R1 either alters CTDNEP1's substrate specificity or enhances its catalytic activity through conformational changes.

The spatially controlled activation of lipins by the CNEP1R1-CTDNEP1 complex at the nuclear envelope creates a phospholipid gradient that influences membrane properties and endoplasmic reticulum structure around the nucleus .

What are the most effective methods for studying CNEP1R1 function in cellular models?

Several complementary approaches are effective for investigating CNEP1R1 function:

  • Gene Silencing/Knockout Approaches:

    • CRISPR-Cas9 gene editing using validated gRNA sequences targeting Cnep1r1 has been established .

    • Multiple guide RNAs should be tested as the Zhang lab recommends using at least two gRNA constructs per gene to increase success rates .

    • RNAi approaches with siRNA or shRNA targeting CNEP1R1 can provide temporal control over gene silencing.

  • Protein Localization and Interaction Studies:

    • Co-immunoprecipitation of CNEP1R1 with CTDNEP1 and lipins to confirm physical interactions.

    • Fluorescence microscopy using tagged CNEP1R1 constructs to visualize subcellular localization.

    • Proximity ligation assays to detect protein-protein interactions in situ.

  • Functional Assays:

    • Lipin dephosphorylation assays in the presence or absence of CNEP1R1.

    • Membrane fractionation to assess nuclear envelope integrity and ER structure.

    • Phospholipid analysis by mass spectrometry to measure changes in phosphatidic acid, diacylglycerol, and phosphatidylinositol levels.

  • Model Systems:

    • C. elegans embryos provide an excellent model for studying CNEP1R1's role in nuclear envelope dynamics during cell division .

    • Yeast complementation assays using nem1Δ spo7Δ strains can assess the functionality of human CNEP1R1 and CTDNEP1 .

How can recombinant CNEP1R1 be effectively expressed and purified for biochemical studies?

Effective expression and purification of recombinant CNEP1R1 requires careful consideration of expression systems and purification strategies:

  • Expression Systems:

    • Bacterial expression systems (E. coli) with appropriate fusion tags (e.g., His6, GST, MBP) can be used for expressing soluble domains of CNEP1R1.

    • Mammalian expression systems (HEK293, CHO cells) are recommended for full-length protein to ensure proper folding and post-translational modifications.

    • Baculovirus-insect cell systems provide a compromise between bacterial and mammalian systems.

  • Vector Selection:

    • Standard expression vectors like pcDNA3.1+/C-(K)DYK have been used for CNEP1R1 cloning .

    • The selection of appropriate promoters (e.g., CMV for mammalian expression) is crucial for high-level expression.

  • Purification Strategy:

    • Affinity chromatography using tagged constructs (His-tag, FLAG-tag) provides a first purification step.

    • Size-exclusion chromatography to separate properly folded protein from aggregates.

    • Ion-exchange chromatography for further purification based on charge properties.

  • Co-expression Considerations:

    • Co-expression with CTDNEP1 may improve stability and solubility.

    • Expression of transmembrane domain-truncated versions may increase solubility while maintaining interaction capabilities.

The purified recombinant protein can then be used for in vitro phosphatase assays, structural studies, and protein-protein interaction analyses. It's worth noting that the membrane-associated nature of CNEP1R1 may complicate full-length protein expression and purification, potentially requiring detergent solubilization or membrane mimetics.

What assays are available to measure CNEP1R1-CTDNEP1 phosphatase activity in vitro?

Several assays have been developed to measure the phosphatase activity of the CNEP1R1-CTDNEP1 complex:

  • Phosphopeptide-based Assays:

    • Synthetic phosphopeptides derived from lipin-1 sequences can be used as substrates .

    • Released phosphate can be quantified using malachite green or other colorimetric phosphate detection methods.

  • Recombinant Protein Substrate Assays:

    • Phosphorylated recombinant lipin proteins serve as more physiologically relevant substrates.

    • Changes in phosphorylation state can be detected by:

      • Phospho-specific antibodies in Western blotting

      • Mass spectrometry to identify specific dephosphorylation sites

      • Mobility shift assays as dephosphorylated lipins show altered migration patterns in SDS-PAGE

  • In-gel Phosphatase Assays:

    • Incorporating phosphorylated substrates into polyacrylamide gels allows visualization of phosphatase activity after native gel electrophoresis.

  • Membrane-based Assays:

    • Reconstitution of CNEP1R1-CTDNEP1 complex in liposomes or nanodiscs with incorporated phospholipid substrates.

    • Analysis of phospholipid conversion by thin-layer chromatography or mass spectrometry.

When designing these assays, it's important to remember that the catalytic activity resides in CTDNEP1, while CNEP1R1 serves as the essential regulatory partner. Research has shown that soluble fragments of CTDNEP1 can dephosphorylate peptides derived from lipin-1 with good kinetics, but intact CNEP1R1 is required for efficient dephosphorylation of full-length lipin proteins in cellular contexts .

How does CNEP1R1 regulate nuclear envelope structure and dynamics during cell division?

CNEP1R1 plays a crucial role in nuclear envelope dynamics during cell division through several mechanisms:

  • Nuclear Envelope Breakdown (NEBD):

    • The CNEP1R1-CTDNEP1 complex regulates lipin activity, which affects diacylglycerol (DAG) levels at the nuclear envelope.

    • DAG is required for protein kinase C (PKC) activation, which phosphorylates nuclear lamins to promote their disassembly during NEBD .

    • In C. elegans embryos, inhibition of CNEP1R1, CTDNEP1, or lipin-1 results in defective nuclear envelope breakdown after zygote formation .

  • Endoplasmic Reticulum Sheet Formation:

    • CNEP1R1 inhibition leads to ectopic ER sheets that encircle the nuclear envelope, forming an extra ER layer .

    • These extra ER sheets physically impede nuclear envelope breakdown and disassembly during mitosis .

    • Transmission electron microscopy (TEM) reveals a substantial increase in ER sheets near the nuclear envelope in CNEP1R1-deficient cells .

  • Phospholipid Gradient Maintenance:

    • CNEP1R1 spatially controls phospholipid flux, preventing excessive phosphatidylinositol (PI) levels near the nuclear envelope .

    • This regulation creates a phospholipid gradient that influences membrane properties required for proper nuclear envelope disassembly and reassembly.

The orchestrated phosphorylation and dephosphorylation events involving various phosphatases, including the CNEP1R1-CTDNEP1 complex, are essential for the remodeling of the nuclear envelope during its disassembly and reformation after cell division . Disruptions in this process can lead to abnormal nuclear envelope structure and defects in cellular division.

What is the relationship between CNEP1R1 and lipin activation in phospholipid metabolism?

CNEP1R1 plays a central role in lipin activation through several mechanisms:

  • Dephosphorylation-Dependent Activation:

    • Lipins (including lipin-1a, lipin-1b, and lipin-2) are inactivated by phosphorylation through multiple kinases.

    • The CNEP1R1-CTDNEP1 complex dephosphorylates lipins, converting them to their active form .

    • In mammalian cells, CTDNEP1 can effectively dephosphorylate lipins only in the presence of CNEP1R1 .

  • Regulation of Lipin Subcellular Localization:

    • Dephosphorylated lipins show increased nuclear localization.

    • When CTDNEP1 and CNEP1R1 are co-expressed, the nuclear fraction of lipin-1b is significantly increased .

    • This regulated translocation affects both lipin's enzymatic activity and potential transcriptional coregulator functions.

  • Conservation of the Regulatory Mechanism:

    • The lipin activation system is evolutionarily conserved from yeast to humans.

    • In yeast, Pah1p (lipin ortholog) is activated by the Nem1p-Spo7p complex, with CTDNEP1 and CNEP1R1 being the respective metazoan orthologs .

    • Human CTDNEP1 and CNEP1R1 can functionally complement a nem1Δ spo7Δ yeast strain, restoring triacylglycerol levels and normal lipid droplet number .

  • Metabolic Consequences:

    • Activated lipins convert phosphatidic acid (PA) to diacylglycerol (DAG).

    • This conversion affects:

      • Triacylglycerol synthesis and lipid droplet formation

      • Phospholipid synthesis pathways

      • Membrane properties and curvature

      • Signaling lipid availability

The coordinated expression of CNEP1R1, CTDNEP1, and lipin-1 in human and mouse tissues further supports their functional relationship. Their expression patterns closely mirror each other, suggesting co-regulation and interdependent functions .

How do environmental factors and chemical exposures affect CNEP1R1 expression and function?

CNEP1R1 expression and function can be significantly altered by various environmental factors and chemical exposures, as evidenced by gene-chemical interaction annotations in rat studies:

  • Environmental Toxicants:

    • Tetrachlorodibenzodioxin (TCDD) decreases CNEP1R1 mRNA expression in rats through experimentally verified mechanisms .

    • Benzo[a]pyrene affects methylation of the CNEP1R1 3' UTR, potentially altering its expression through epigenetic mechanisms .

    • Arsenic exposure, particularly when co-administered with manganese, increases CNEP1R1 mRNA expression .

  • Endocrine Disruptors:

    • Bisphenol A (BPA) shows bidirectional effects on CNEP1R1 expression, with studies reporting both increased and decreased expression under different conditions .

    • This suggests context-dependent regulation that may vary based on tissue type, exposure duration, or developmental stage.

  • Metabolic Factors:

    • Lactic acid decreases CNEP1R1 mRNA expression, indicating sensitivity to metabolic state and pH conditions .

    • 1,2-dimethylhydrazine decreases CNEP1R1 expression, with this effect being modified by co-treatment with folic acid .

  • Molecular Mechanisms:

    • Chemical exposures may alter CNEP1R1 function through:

      • Transcriptional regulation of gene expression

      • Post-translational modifications affecting protein stability or activity

      • Altered protein-protein interactions with CTDNEP1 or other partners

      • Changes in subcellular localization affecting access to substrates

These interactions suggest that CNEP1R1 may serve as a molecular link between environmental exposures and alterations in phospholipid metabolism, nuclear envelope integrity, and cellular division. The diverse array of chemicals affecting CNEP1R1 expression indicates its potential role as a mediator of cellular responses to environmental stressors.

How conserved is CNEP1R1 across species, and what does this tell us about its evolutionary importance?

CNEP1R1 shows remarkable conservation across metazoan species, indicating its fundamental importance in eukaryotic cell biology:

  • Sequence Conservation:

    • CNEP1R1 orthologs have been identified across diverse mammalian species, including humans, mice, rats, Pantholops hodgsonii (chiru) , and Miniopterus natalensis (bat) .

    • The functional domains of CNEP1R1, particularly those mediating interaction with CTDNEP1, show high sequence conservation.

  • Functional Conservation:

    • The CNEP1R1-CTDNEP1 complex is the metazoan counterpart of the yeast Spo7p-Nem1p complex .

    • Human CNEP1R1 and CTDNEP1 can functionally complement a nem1Δ spo7Δ yeast strain, demonstrating deep evolutionary conservation of function .

    • In C. elegans, nematode CTDNEP1 and NEP1-R1 (CNEP1R1) function similarly to their mammalian counterparts in regulating nuclear envelope dynamics .

  • Evolutionary Implications:

    • The conservation of this regulatory system from yeast to humans suggests that the mechanism of lipin regulation by a membrane-associated phosphatase complex emerged early in eukaryotic evolution.

    • The presence of CNEP1R1 pseudogenes (e.g., CNEP1R1P1 on chromosome Xq22.2 in humans) indicates gene duplication events during evolution.

    • The maintenance of this regulatory system across diverse species points to its essential role in membrane homeostasis and cell division.

  • Comparative Gene Expression:

    • The expression patterns of CNEP1R1 and CTDNEP1 in human and mouse tissues closely mirror that of lipin-1 .

    • This co-expression pattern further supports their functional interdependence and evolutionary co-selection.

The high degree of conservation suggests that the CNEP1R1-CTDNEP1-lipin regulatory axis represents a fundamental mechanism for controlling membrane lipid composition, essential for eukaryotic cell function and division.

What structural and functional differences exist between CNEP1R1 in different model organisms?

  • Size and Domain Organization:

    • The length of CNEP1R1 varies across species, with differences in N- and C-terminal extensions.

    • Pantholops hodgsonii CNEP1R1 isoforms X1 and X2 show variation in their N-terminal regions .

    • Miniopterus natalensis CNEP1R1 has a coding sequence of 483 nucleotides, encoding a protein of approximately 160 amino acids .

  • Isoform Diversity:

    • Humans and other mammals express multiple CNEP1R1 isoforms through alternative splicing .

    • The functional significance of these isoforms may include tissue-specific roles or differential regulation of CTDNEP1 activity.

  • Subcellular Localization:

    • While primarily localized to the nuclear envelope across species, the relative distribution between nuclear envelope and peripheral ER may vary.

    • The degree of co-localization with CTDNEP1 may differ between organisms, potentially affecting spatial regulation of lipin activity.

  • Regulatory Sensitivity:

    • Rat Cnep1r1 shows sensitivity to various chemical exposures , but the conservation of these regulatory responses across species remains to be fully characterized.

    • Species-specific post-translational modifications may provide additional layers of regulation.

  • Functional Consequences in Model Systems:

    • In C. elegans, CNEP1R1 deficiency affects nuclear envelope breakdown during early embryonic divisions .

    • In yeast, Spo7p (CNEP1R1 ortholog) deficiency leads to nuclear envelope expansion and defects in lipid droplet formation .

    • In mammalian cells, CNEP1R1 regulates both nuclear envelope dynamics and ER sheet formation near the nucleus .

These differences provide opportunities for comparative studies to understand the core functions of CNEP1R1 versus species-specific adaptations. The use of multiple model organisms in CNEP1R1 research allows for a more comprehensive understanding of its biological roles across evolutionary distances.

How do gene knockout studies in model organisms inform our understanding of CNEP1R1 function?

Gene knockout and knockdown studies in various model organisms have provided valuable insights into CNEP1R1 function:

  • C. elegans Studies:

    • In C. elegans embryos, knockdown of CNEP1R1 (NEP1-R1) impairs nuclear envelope breakdown after zygote formation .

    • These defects phenocopy CTDNEP1 and lipin-1 knockdowns, confirming their functional relationship in vivo .

    • The early embryonic lethality underscores the essential nature of this regulatory pathway in development.

  • Yeast Studies:

    • In S. cerevisiae, deletion of SPO7 (CNEP1R1 ortholog) causes:

      • Severe decrease in triacylglycerol levels

      • Reduction in lipid droplet number

      • Expansion of the nuclear envelope

      • Altered phospholipid synthesis

    • These phenotypes can be rescued by expression of human CNEP1R1 and CTDNEP1, demonstrating functional conservation .

  • Mammalian Models:

    • CRISPR-Cas9 targeting of mouse Cnep1r1 has been developed, enabling generation of knockout cell lines and potentially knockout mice .

    • Cnep1r1-deficient cells show alterations in phospholipid metabolism and ER structure.

  • Molecular Insights from Knockout Studies:

    • CNEP1R1 deficiency leads to:

      • Increased phosphorylation of lipins

      • Decreased nuclear localization of lipin-1b

      • Altered phospholipid profiles, particularly increased phosphatidylinositol levels

      • Formation of ectopic ER sheets near the nuclear envelope

  • Compensatory Mechanisms:

    • Partial inhibition of phosphatidylinositol synthesis can suppress the ectopic ER sheet formation and nuclear envelope disassembly defects in CNEP1R1-deficient cells .

    • This suggests that altered phospholipid balance is a primary mechanism underlying CNEP1R1 deficiency phenotypes.

These knockout studies collectively demonstrate that CNEP1R1 functions in a conserved pathway controlling phospholipid metabolism, with impacts on nuclear envelope dynamics, ER structure, and cellular division across diverse species. The consistency of phenotypes across evolutionary distance underscores the fundamental importance of this regulatory system.

How might CNEP1R1 dysregulation contribute to human disease pathogenesis?

While direct links between CNEP1R1 mutations and human diseases are still emerging, several mechanistic connections suggest potential pathogenic roles:

  • Nuclear Envelope-Related Diseases:

    • CNEP1R1 dysregulation could contribute to laminopathies and other nuclear envelope-related disorders by affecting nuclear envelope stability and dynamics.

    • Defects in nuclear envelope breakdown during mitosis could lead to chromosomal segregation errors and genomic instability .

  • Lipid Metabolism Disorders:

    • Given its role in regulating lipin activity, CNEP1R1 dysfunction may contribute to disorders of phospholipid metabolism.

    • Lipin-1 mutations cause lipodystrophy in mice and acute myopathy in humans , suggesting CNEP1R1 dysregulation might impact similar pathways.

    • The CNEP1R1-CTDNEP1-lipin axis affects triacylglycerol synthesis, potentially influencing fat storage disorders.

  • Cell Division Defects:

    • Impaired nuclear envelope dynamics can cause micronuclei formation , which is associated with cancer progression.

    • Disruption of proper phospholipid gradients could affect cellular membrane integrity during division.

  • Response to Environmental Toxicants:

    • The sensitivity of CNEP1R1 expression to environmental chemicals suggests it might serve as a mediator of toxicant-induced cellular damage.

    • CNEP1R1 regulation by bisphenol A and other endocrine disruptors hints at potential roles in endocrine-related disorders.

  • Nervous System Development:

    • The original identification of CTDNEP1 (dullard) through its effects on Xenopus neural development suggests the CNEP1R1-CTDNEP1 complex might influence neurodevelopmental processes.

Research on these potential disease connections is still in its early stages, but understanding the fundamental cellular roles of CNEP1R1 provides a foundation for investigating its contributions to pathological conditions.

What are the methodological challenges in studying CNEP1R1-CTDNEP1 complex formation and activation?

Studying the CNEP1R1-CTDNEP1 complex presents several methodological challenges:

  • Membrane Protein Biochemistry:

    • Both CNEP1R1 and CTDNEP1 are membrane-associated proteins, making them difficult to solubilize while maintaining native structure and interactions.

    • Reconstitution of the complex in artificial membrane systems (liposomes, nanodiscs) is technically challenging.

    • Detergent selection for solubilization can significantly affect complex stability and activity.

  • Structural Analysis:

    • Obtaining high-resolution structures of membrane protein complexes remains difficult.

    • Crystallization of the CNEP1R1-CTDNEP1 complex is complicated by membrane association and potential conformational flexibility.

    • Cryo-electron microscopy approaches may be limited by the relatively small size of the complex.

  • In Vivo Complex Formation:

    • Visualizing the dynamic association of CNEP1R1 and CTDNEP1 in living cells requires specialized approaches.

    • Fluorescent protein tagging may interfere with proper localization or function.

    • The potential for transient interactions or sub-stoichiometric complex formation complicates analysis.

  • Activity Assays:

    • Reconstituting physiologically relevant activity in vitro requires both membrane context and appropriate substrates.

    • The spatial regulation aspect of CNEP1R1-CTDNEP1 function is difficult to recapitulate in cell-free systems.

    • Multiple phosphorylation sites on lipin substrates complicate the interpretation of dephosphorylation kinetics.

  • Methodological Solutions:

    • Proximity-dependent labeling techniques (BioID, APEX) can map interaction networks in native cellular contexts.

    • Single-molecule approaches may reveal dynamic aspects of complex formation.

    • Reconstitution in supported lipid bilayers with defined composition could help understand lipid environment effects.

    • CRISPR-based tagging at endogenous loci minimizes artifacts associated with overexpression.

Overcoming these challenges will require integrating multiple complementary approaches, from biochemical reconstitution to advanced cellular imaging, to fully understand the CNEP1R1-CTDNEP1 complex dynamics and function.

What are the emerging therapeutic opportunities related to modulating CNEP1R1 function?

While therapeutic targeting of CNEP1R1 is still in conceptual stages, several promising opportunities are emerging:

  • Nuclear Envelope Dynamics Modulation:

    • Targeting the CNEP1R1-CTDNEP1 complex could provide novel approaches to regulate nuclear envelope breakdown and reassembly.

    • This could be relevant for anti-cancer strategies by influencing mitotic progression in rapidly dividing cells.

    • Small molecules that modulate CNEP1R1-CTDNEP1 interaction might allow temporal control over nuclear envelope dynamics.

  • Phospholipid Metabolism Intervention:

    • The role of CNEP1R1 in regulating lipin activity makes it a potential target for disorders of lipid metabolism.

    • Modulating CNEP1R1 function could influence the balance between phosphatidic acid and diacylglycerol, affecting downstream lipid signaling pathways.

    • This approach might be relevant for metabolic disorders, including certain forms of lipodystrophy.

  • ER Stress Response Targeting:

    • CNEP1R1's influence on ER sheet formation suggests it may affect cellular responses to ER stress.

    • Compounds altering CNEP1R1 function could potentially modulate the unfolded protein response, relevant for neurodegenerative diseases where ER stress plays a role.

  • Developmental Therapeutics:

    • Understanding CNEP1R1's role in cellular division during development could inform approaches to developmental disorders.

    • Temporal modulation of CNEP1R1 activity might influence stem cell differentiation processes.

  • Methodological Approaches:

    • Structure-based drug design targeting the CNEP1R1-CTDNEP1 interface.

    • High-throughput screening for compounds that modulate complex formation or activity.

    • Peptide-based inhibitors derived from interaction domains.

    • RNA therapeutics (siRNA, ASOs) for selective tissue-specific modulation of CNEP1R1 expression.

Given the fundamental cellular processes influenced by CNEP1R1, therapeutic interventions would require careful targeting to specific tissues or developmental stages to avoid disrupting essential functions. The continued characterization of CNEP1R1's roles across different contexts will be crucial for identifying the most promising therapeutic applications.

What are the key unresolved questions in CNEP1R1 research?

Despite significant advances in understanding CNEP1R1 function, several important questions remain:

  • Structural Biology Questions:

    • What is the high-resolution structure of the CNEP1R1-CTDNEP1 complex, and how does complex formation alter CTDNEP1's catalytic activity?

    • How does CNEP1R1 orient within the nuclear envelope membrane, and what determines its enrichment at this location versus other ER domains?

  • Regulatory Mechanisms:

    • How is CNEP1R1 expression and activity regulated in different tissues and developmental stages?

    • Are there additional binding partners beyond CTDNEP1 that modulate CNEP1R1 function?

    • What post-translational modifications affect CNEP1R1 activity and localization?

  • Physiological Functions:

    • Beyond nuclear envelope dynamics, what other cellular processes require CNEP1R1-CTDNEP1 function?

    • How does CNEP1R1 contribute to tissue-specific phospholipid metabolism and membrane organization?

    • What is the role of CNEP1R1 in non-dividing, differentiated cells?

  • Pathological Relevance:

    • Are there human diseases directly linked to CNEP1R1 mutations or dysregulation?

    • How does CNEP1R1 function change during aging or in response to cellular stress?

    • Could CNEP1R1 serve as a biomarker for specific disease states?

Addressing these questions will require continued interdisciplinary research combining structural biology, biochemistry, cell biology, and genetic approaches across model systems.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.