Recombinant Human Nucleolar complex protein 4 homolog (NOC4L)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder

Note: We will prioritize shipping the format currently in stock. If you require a specific format, please specify this in your order comments.

Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.

Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.

Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during manufacturing.

Tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.

Synonyms
NOC4L; Nucleolar complex protein 4 homolog; NOC4 protein homolog; NOC4-like protein; Nucleolar complex-associated protein 4-like protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-516
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
NOC4L
Target Protein Sequence
MEREPGAAGVRRALGRRLEAVLASRSEANAVFDILAVLQSEDQEEIQEAVRTCSRLFGAL LERGELFVGQLPSEEMVMTGSQGATRKYKVWMRHRYHSCCNRLGELLGHPSFQVKELALS ALLKFVQLEGAHPLEKSKWEGNYLFPRELFKLVVGGLLSPEEDQSLLLSQFREYLDYDDT RYHTMQAAVDAVARVTGQHPEVPPAFWNNAFTLLSAVSLPRREPTVSSFYVKRAELWDTW KVAHLKEHRRVFQAMWLSFLKHKLPLSLYKKVLLIVHDAILPQLAQPTLMIDFLTRACDL GGALSLLALNGLFILIHKHNLEYPDFYRKLYGLLDPSVFHVKYRARFFHLADLFLSSSHL PAYLVAAFAKRLARLALTAPPEALLMVLPFICNLLRRHPACRVLVHRPHGPELDADPYDP GEEDPAQSRALESSLWELQALQRHYHPEVSKAASVINQALSMPEVSIAPLLELTAYEIFE RDLKKKGPEPVPLEFIPAQGLLGRPGELCAQHFTLS
Uniprot No.

Target Background

Gene References Into Functions
  1. This research provides the first in vivo genetic evidence demonstrating the critical roles of Noc4l in early mouse embryogenesis. PMID: 28012024
Database Links

HGNC: 28461

OMIM: 612819

KEGG: hsa:79050

STRING: 9606.ENSP00000328854

UniGene: Hs.558536

Protein Families
CBF/MAK21 family
Subcellular Location
Nucleus membrane; Multi-pass membrane protein. Nucleus, nucleolus.

Q&A

What is NOC4L and what is its evolutionary relationship to yeast Noc4p?

NOC4L (Nucleolar Complex Associated 4 Homolog) is the human ortholog of yeast Noc4p. The human NOC4L encodes an approximately 58-kDa protein consisting of 516 amino acids. Similar to Noc4p, NOC4L contains a highly conserved Noc domain comprising 45 amino acids at its C-terminus (residue 416-460) . In yeast, Noc4p forms a stable heterodimer with Nop14p, which mediates the maturation and nuclear export of 40S ribosomal subunits . This suggests evolutionary conservation of function related to ribosome biogenesis, although human NOC4L has evolved additional functions in immune and metabolic regulation.

What is the tissue distribution pattern of NOC4L in humans and mice?

RNA-seq data analysis shows that NOC4L is highly expressed in testis, adipose tissue, and immune organs in humans . In mice, FACS-based full-length transcript analysis demonstrates that Noc4l is highly expressed in bone marrow . Double immunofluorescence analyses using NOC4L and macrophage markers (F4/80 or Mac-2) revealed that NOC4L co-localizes with these markers in both mouse and human adipose tissue, indicating predominant expression in adipose tissue macrophages (ATMs) . Additionally, flow cytometry studies have shown significant expression in CD4+ T cells, particularly when activated .

How does NOC4L function at the cellular level?

NOC4L functions at multiple cellular levels:

  • Ribosome biogenesis: Similar to its yeast homolog, NOC4L participates in the assembly and transport of 40S ribosomal subunits .

  • Immune regulation: In macrophages, NOC4L interacts with TLR4 (Toll-like receptor 4) to inhibit its endocytosis and block the TRIF pathway, thereby reducing inflammatory responses . In T cells, NOC4L expression increases upon activation and is associated with cell proliferation and division .

  • Metabolic regulation: NOC4L expression in macrophages affects systemic insulin sensitivity and glucose metabolism. Macrophage-specific deletion of Noc4l in mice leads to insulin resistance and low-grade systemic inflammation .

These multifaceted functions position NOC4L at the intersection of cellular metabolism, immune function, and protein synthesis regulation.

How is NOC4L expression altered in obesity and what are the metabolic consequences?

NOC4L expression is significantly decreased in both obese humans and mice . This reduced expression correlates with metabolic dysfunction. Data mining from the ATTIE LAB DIABETES DATABASE revealed that glucose levels are negatively correlated with Noc4l transcripts when compared against all diabetes-related clinical traits .

Metabolic parameters affected by Noc4l deletion in mouse macrophages include:

ParameterEffect of macrophage-specific Noc4l deletion
Fasting blood glucoseSignificantly increased in HFD-fed mice
Serum insulinSignificantly increased
Free fatty acids (FFAs)Significantly increased
Triglycerides (TGs)Significantly increased
Cholesterol (CHOL)Significantly increased
Glucose toleranceSignificantly impaired
Insulin sensitivitySignificantly impaired
Energy expenditureDecreased on both normal and high-fat diet

These findings demonstrate that macrophage NOC4L plays a crucial role in maintaining metabolic homeostasis, particularly under high-fat diet conditions .

What is the experimental evidence linking NOC4L to insulin resistance?

Several experimental approaches have established the role of NOC4L in insulin resistance:

  • Lentivirus-mediated overexpression: Overexpression of Noc4l in diet-induced obese (DIO) mice via tail intravenous injection of Lv-Noc4l decreased glucose intolerance, improved insulin resistance, and reduced total fat weight, including epididymal, inguinal, and perinephric fat deposits. Symptoms of fatty liver were also reduced .

  • Macrophage-specific knockout: Myeloid-specific deletion of Noc4l (Noc4l LKO) led to insulin resistance and glucose intolerance, particularly when mice were fed a high-fat diet. These mice exhibited higher fasting blood glucose, serum insulin, free fatty acids, triglycerides, and cholesterol .

  • Metabolic cage studies: Noc4l LKO mice showed decreased oxygen consumption, VCO2 production, and energy expenditure compared to control mice, indicating that NOC4L affects systemic energy metabolism .

  • Correlation studies: Mining of the ATTIE LAB DIABETES DATABASE showed glucose levels as the factor most negatively correlated with Noc4l transcripts among all diabetes-related clinical traits .

These complementary approaches provide strong evidence for NOC4L's role in regulating insulin sensitivity and glucose metabolism.

How does NOC4L regulate macrophage polarization and inflammatory responses?

NOC4L plays a critical role in regulating macrophage polarization toward anti-inflammatory phenotypes. Experimental evidence shows:

  • Effect on M1/M2 polarization: Bone marrow-derived macrophages (BMDMs) from Noc4l LKO mice showed significantly increased responses to LPS stimulation, with enhanced transcriptional expression of pro-inflammatory cytokines including IL-6, TNFα, and MCP1, indicating preferential M1-like polarization .

  • Response to metabolic triggers: When treated with palmitic acid (PA), BMDMs from Noc4l LKO mice expressed much higher levels of IL-6 and showed an upward trend in TNFα expression compared to control mice .

  • Mechanism of action: NOC4L interacts with TLR4 to inhibit its endocytosis and block the TLR4/TRIF pathway in endosomes of macrophages. This interaction provides a mechanistic explanation for how NOC4L modulates inflammatory signaling .

These findings suggest that NOC4L functions as a negative regulator of macrophage-mediated inflammation, particularly in the context of metabolic stress.

What is the role of NOC4L in T cell activation and proliferation?

Recent studies have revealed important functions of NOC4L in T cell biology:

  • Expression dynamics: Flow cytometry analysis of transgenic reporter mice expressing Noc4l-mCherry showed increased expression levels of NOC4L in activated CD4+ T cells .

  • Correlation with proliferation: NOC4L expression is closely associated with the proliferation and division of activated T cells, particularly under Th1 and Th17 polarization conditions .

  • Protein interactions: In vitro experiments identified interactions between NOC4L and proteins involved in ribosome assembly and cell proliferation during T cell activation, suggesting a role in coordinating protein synthesis with T cell activation .

These findings suggest that NOC4L may function as a translational regulator during T cell activation, potentially coordinating ribosome biogenesis with the increased protein synthesis demands of proliferating T cells.

What are the most effective knockout strategies for studying NOC4L function?

Since complete deletion of Noc4l leads to embryonic lethality in mice , conditional knockout approaches are essential:

  • Tissue-specific knockout using Cre-loxP system: The LysM-Cre system has been successfully used to generate macrophage-specific Noc4l knockout mice (Noc4l LKO) . This approach allows for the study of NOC4L function in specific cell types while avoiding developmental lethality.

  • Inducible knockout systems: Temporal control of Noc4l deletion using inducible Cre recombinases (e.g., tamoxifen-inducible CreERT2) would allow for the study of NOC4L function at different developmental stages or in adult tissues.

  • In vitro CRISPR-Cas9: For cellular studies, CRISPR-Cas9-mediated knockout of NOC4L in relevant cell lines (macrophages, T cells) can provide insights into cell-autonomous functions.

When designing knockout strategies, researchers should verify knockout efficiency using specific antibodies. Both monoclonal (3L7) and polyclonal (6R) antibodies have been successfully used to detect NOC4L expression .

What methods are most suitable for detecting NOC4L protein interactions?

To investigate NOC4L's interactions with other proteins:

  • Co-immunoprecipitation (Co-IP): This approach has successfully demonstrated the interaction between NOC4L and TLR4 in macrophages .

  • Proximity ligation assay (PLA): For detecting protein-protein interactions in situ with high sensitivity.

  • Mass spectrometry-based interactome analysis: This approach has identified interactions between NOC4L and proteins involved in ribosome assembly and cell proliferation during T cell activation .

  • Fluorescence resonance energy transfer (FRET): For visualizing protein interactions in living cells.

  • Yeast two-hybrid screening: To identify novel interaction partners.

When studying NOC4L interactions, researchers should consider compartment-specific interactions, as NOC4L has been shown to interact with TLR4 at the cell membrane and endosomes, affecting TLR4 internalization and signaling .

How does NOC4L connect ribosome biogenesis to immune cell function?

While NOC4L's role in ribosome biogenesis is evolutionarily conserved from yeast to humans, its specific functions in immune cells remain incompletely understood. Advanced research questions include:

  • Selective translation regulation: Does NOC4L influence the translation of specific mRNAs in immune cells? Recent evidence suggests that Noc4l-deficient T cells have a smaller 40S ribosomal subunit peak, which selectively controls protein translation in regulatory and conventional T cells .

  • Coordination with metabolic pathways: How does NOC4L integrate immune cell activation with metabolic reprogramming? The dual role of NOC4L in metabolism and inflammation suggests a coordinating function.

  • Subcellular localization dynamics: How does NOC4L trafficking between the nucleolus, cytoplasm, and cell membrane regulate its diverse functions?

Investigating these questions will require integrative approaches combining ribosome profiling, translatomics, and metabolic analyses in relevant immune cell populations.

What is the therapeutic potential of targeting NOC4L in metabolic and inflammatory diseases?

Given NOC4L's roles in metabolic regulation and inflammation, it represents a potential therapeutic target:

  • Upregulation strategies: Since NOC4L levels are decreased in obesity and its overexpression improves metabolic parameters, approaches to increase NOC4L expression or activity might be beneficial. Lentiviral delivery of Noc4l has shown efficacy in mouse models .

  • Small molecule modulation: Identifying compounds that stabilize NOC4L or enhance its interaction with TLR4 could provide anti-inflammatory benefits without broadly suppressing immunity.

  • Cell-specific targeting: Given the importance of NOC4L in macrophages, T cells, and potentially other cell types, cell-targeted delivery strategies would maximize therapeutic benefit while minimizing off-target effects.

  • Biomarker potential: NOC4L expression levels could serve as a biomarker for inflammation status and metabolic health, particularly in adipose tissue.

Future research should explore these therapeutic applications while carefully considering the essential roles of NOC4L in ribosome biogenesis and cellular homeostasis.

What are the optimal conditions for recombinant NOC4L protein production and purification?

Based on available research tools and recombinant protein production methods:

  • Expression systems:

    • Cell-free protein synthesis (CFPS) has been successfully used to produce recombinant NOC4L with Strep Tag

    • HEK-293 cells can also be used for expression of human NOC4L with post-translational modifications

  • Purification approaches:

    • Affinity chromatography using Strep-Tactin for Strep-tagged NOC4L

    • Size exclusion chromatography (SEC) for further purification

  • Quality control:

    • SDS-PAGE and Western blotting to confirm protein size and integrity

    • ELISA to verify tag accessibility

    • Analytical SEC (HPLC) to assess purity and aggregation state

Recombinant NOC4L proteins produced via these methods typically achieve >70-80% purity as determined by SDS-PAGE, Western Blot, and analytical SEC .

What are the most informative experimental models for studying NOC4L in metabolic disease?

Several experimental models have proven valuable for studying NOC4L's role in metabolic disease:

  • Diet-induced obesity (DIO) mouse models: High-fat diet feeding of mice with macrophage-specific Noc4l deletion or overexpression has revealed important metabolic functions of NOC4L .

  • In vitro macrophage systems:

    • Bone marrow-derived macrophages (BMDMs) treated with LPS or palmitic acid (PA)

    • Polarization toward M1 or M2 phenotypes using LPS or IL-4, respectively

  • Human samples: Analysis of NOC4L expression in adipose tissue macrophages from lean versus obese subjects has provided translational relevance .

  • Reporter systems: Noc4l-mCherry transgenic reporter mice allow for tracking NOC4L expression in different cell types and conditions .

When designing metabolic studies, researchers should consider both acute and chronic models, as well as the interaction between different cell types, particularly in adipose tissue microenvironments where macrophages interact with adipocytes.

What are the common challenges in NOC4L detection and quantification?

Researchers may encounter several technical challenges when studying NOC4L:

  • Antibody specificity: Verify antibody specificity using appropriate controls, such as NOC4L-ablated cells. Both monoclonal (3L7) and polyclonal (6R) antibodies have been validated for NOC4L detection .

  • Low expression levels: In certain cell types or conditions, NOC4L expression may be low. Consider using more sensitive detection methods such as immunoprecipitation followed by Western blotting or PCR-based quantification of mRNA.

  • Subcellular localization: NOC4L may localize to different cellular compartments depending on cell type and activation state. Use appropriate subcellular fractionation techniques or immunofluorescence microscopy with validated antibodies.

  • Post-translational modifications: Consider that NOC4L may undergo post-translational modifications that affect its detection or function. Mass spectrometry approaches can help identify such modifications.

How can researchers effectively study NOC4L's dual roles in ribosome biogenesis and immune signaling?

To investigate NOC4L's diverse functions:

  • Domain-specific mutations: Generate NOC4L mutants affecting specific domains (e.g., the Noc domain) to dissect domain-specific functions.

  • Polysome profiling: Analyze ribosome assembly and translation efficiency in cells with altered NOC4L expression.

  • Temporal analysis: Study the kinetics of NOC4L involvement in both ribosome biogenesis and immune signaling using time-course experiments with synchronization techniques.

  • Interactome analysis in different contexts: Compare NOC4L interaction partners under different conditions (e.g., basal state, LPS stimulation, metabolic stress) to understand context-specific functions.

  • Correlation studies: Analyze the correlation between NOC4L-dependent changes in ribosome biogenesis and immune responses to identify potential mechanistic links.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.