Recombinant Human Nucleoporin NDC1 (TMEM48)

Shipped with Ice Packs
In Stock

Description

Protein Overview

NDC1 (Nuclear Division Cycle 1), also termed TMEM48, is a 656-amino-acid transmembrane protein with 6–7 membrane-spanning domains . Key features include:

PropertyDetails
Gene AliasesNDC1, NET3, TMEM48
UniProt IDQ9BTX1 (Human)
Entrez Gene ID55706
Molecular FunctionNPC assembly, nuclear envelope anchoring, spindle organization during mitosis
Ortholog Identity78% (Mouse), 78% (Rat)

Product Characteristics

  • Source: HEK293 cells

  • Applications: Western blot (WB), ELISA, immunoprecipitation (IP)

  • Storage: -80°C; stable for 6 months post-shipment

  • Usage Recommendations:

    • 100x molar excess for antibody blocking (IHC/ICC/WB)

    • Pre-incubation with antibody for 30 minutes at RT

Cancer Biology

NDC1 is implicated in tumor progression across multiple cancers:

  • Pancreatic Cancer: Silencing NDC1 inhibits proliferation (MTT/EdU assays), reduces migration (scratch assays), and promotes apoptosis in BxPC-3 and MIA PaCa-2 cell lines .

  • Prognostic Marker: High NDC1 expression correlates with advanced tumor stage, lymph node metastasis, and poor survival in NSCLC, esophageal, and colon cancers .

  • Immune Microenvironment: NDC1 expression associates with immune infiltration (e.g., T cells, macrophages) and immune-related genes (MHC, chemokines) .

Mechanistic Insights

  • Pathway Involvement: Wnt/β-catenin (cervical cancer), E2F targets, mTORC1 signaling (pancreatic cancer) .

  • Drug Sensitivity: Linked to chemoresistance; knockdown enhances apoptosis in NSCLC and pancreatic cancer models .

Pan-Cancer Analysis

  • Expression: Overexpressed in 28 cancer types, including pancreatic adenocarcinoma (PAAD), lung adenocarcinoma (LUAD), and glioblastoma (GBM) .

  • Survival Impact: High NDC1 predicts shorter progression-free survival in 14 cancers .

  • Therapeutic Target: Correlates with TMB/MSI biomarkers, suggesting immunotherapy relevance .

Functional Studies

  • NPC Assembly: Critical for anchoring soluble nucleoporins to the nuclear membrane .

  • Mitotic Regulation: Required for spindle organization and nuclear envelope reformation post-mitosis .

Technical Considerations

  • Experimental Validation: Western blotting requires 5 µg lysate per lane, pre-boiled in SDS buffer .

  • Controls: Use vector-only lysates to distinguish background signals .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes, and we will fulfill your request.
Lead Time
Delivery time may vary based on your purchase method and location. Please consult your local distributor for specific delivery details.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate with us in advance, as additional charges will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference point.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type is determined during production. If you have a preferred tag type, please inform us, and we will prioritize its development.
Synonyms
NDC1; TMEM48; Nucleoporin NDC1; hNDC1; Transmembrane protein 48
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-674
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
NDC1
Target Protein Sequence
MATAVSRPCAGRSRDILWRVLGWRIVASIVWSVLFLPICTTVFIIFSRIDLFHPIQWLSD SFSDLYSSYVIFYFLLLSVVIIIISIFNVEFYAVVPSIPCSRLALIGKIIHPQQLMHSFI HAAMGMVMAWCAAVITQGQYSFLVVPCTGTNSFGSPAAQTCLNEYHLFFLLTGAFMGYSY SLLYFVNNMNYLPFPIIQQYKFLRFRRSLLLLVKHSCVESLFLVRNFCILYYFLGYIPKA WISTAMNLHIDEQVHRPLDTVSGLLNLSLLYHVWLCGVFLLTTWYVSWILFKIYATEAHV FPVQPPFAEGSDECLPKVLNSNPPPIIKYLALQDLMLLSQYSPSRRQEVFSLSQPGGHPH NWTAISRECLNLLNGMTQKLILYQEAAATNGRVSSSYPVEPKKLNSPEETAFQTPKSSQM PRPSVPPLVKTSLFSSKLSTPDVVSPFGTPFGSSVMNRMAGIFDVNTCYGSPQSPQLIRR GPRLWTSASDQQMTEFSNPSPSTSISAEGKTMRQPSVIYSWIQNKREQIKNFLSKRVLIM YFFSKHPEASIQAVFSDAQMHIWALEGLSHLVAASFTEDRFGVVQTTLPAILNTLLTLQE AVDKYFKLPHASSKPPRISGSLVDTSYKTLRFAFRASLKTAIYRITTTFGEHLNAVQASA EHQKRLQQFLEFKE
Uniprot No.

Target Background

Function
Nucleoporin NDC1 (TMEM48) is a component of the nuclear pore complex (NPC), playing a crucial role in the de novo assembly and insertion of the NPC into the nuclear envelope. It is essential for NPC and nuclear envelope formation, potentially by creating a link between the nuclear envelope membrane and soluble nucleoporins, effectively anchoring the NPC within the membrane.
Gene References Into Functions
  1. miR-421 can suppress TMEM48, leading to apoptosis in non-small cell lung cancer (NSCLC) cell lines (A549). PMID: 29906465
  2. In mature human spermatozoa, SEPT12 and NDC1 are primarily colocalized in the centrosome regions; however, NDC1 is only minimally co-expressed with SEPT12 at the annulus of the sperm tail. PMID: 27854341
  3. TMEM48 has significant biological relevance in NSCLC progression. PMID: 26392108
  4. The human homologue NDC1/NET3 contains three FG repeats in its C-terminus, a characteristic feature of many nuclear pore proteins. PMID: 16779818
  5. NDC1-mediated localization of ALADIN to nuclear pore complexes is vital for selective nuclear protein import; disruption of the interaction between ALADIN and NDC1 might contribute to the development of triple-A syndrome. PMID: 19703420
  6. ALADIN is anchored in the nuclear envelope through NDC1, and this interaction is disrupted when ALADIN is mutated. PMID: 19782045

Show More

Hide All

Database Links

HGNC: 25525

OMIM: 610115

KEGG: hsa:55706

STRING: 9606.ENSP00000360483

UniGene: Hs.476525

Protein Families
NDC1 family
Subcellular Location
Nucleus, nuclear pore complex. Nucleus membrane; Multi-pass membrane protein. Note=Central core structure of the nuclear pore complex.

Q&A

What is the structural and functional role of NDC1 in nuclear pore complex assembly?

NDC1 is a conserved transmembrane nucleoporin integral to NPC architecture. It anchors outer ring scaffold components (e.g., Nup107/160 complex) to stabilize NPCs during assembly . Methodologically, its role has been validated through:

  • 3D electron tomography: Revealed a 4.8-fold reduction in NPC density in C. elegans ndc1Δ mutants compared to wild-type .

  • Fluorescence recovery after photobleaching (FRAP): Demonstrated NDC1 immobilizes Nup160 in mature NPCs (mobile fraction reduced from 47% to 20% in ndc1 RNAi-depleted cells) .

  • Gene knockout models: Co-depletion of ndc1 and nup53 in C. elegans disrupts NE formation, indicating redundant roles in NPC assembly .

Table 1: Key Structural Interactions of NDC1

Interaction PartnerFunctional RoleExperimental ValidationSource
Nup107/160 complexStabilizes outer ring scaffoldFRAP, 3D-EM tomography
Nup53Redundant NPC assembly roleGenetic co-depletion assays
ER membrane lipidsCouples NPC density to nuclear sizecnep-1 mutant rescue experiments

How does NDC1 expression correlate with cancer prognosis?

Pan-cancer analyses reveal NDC1 overexpression in 28 cancer types, with prognostic significance in 15 . Key methodologies include:

  • TCGA/GTEx integration: Log2-normalized RNA-seq data identified elevated NDC1 in HCC (HR = 2.1, p < 0.001) , NSCLC (HR = 1.8, p = 0.003) , and pancreatic cancer (HR = 1.6, p = 0.01) .

  • Multivariate Cox regression: NDC1 is an independent prognostic factor for HCC (HR = 1.92, 95% CI: 1.3–2.8) .

  • Kaplan-Meier analysis: High NDC1 predicts reduced progression-free survival in 14 cancers (e.g., pancreatic cancer: median survival 12 vs. 21 months, p = 0.006) .

How can researchers resolve contradictions in NDC1’s oncogenic mechanisms across cancer types?

Discrepancies arise from tissue-specific pathways:

  • Cell cycle dysregulation: In NSCLC, NDC1 knockdown reduces Cyclin B1, CDK1, and PCNA (70% decrease in G1 arrest) .

  • Immune modulation: In HCC, NDC1 correlates with immunosuppressive Treg infiltration (Spearman’s ρ = 0.42, p = 0.002) .

  • Apoptosis regulation: Pancreatic cancer models show NDC1 silencing increases caspase-3 activity by 3-fold .

Methodological recommendations:

  • Pathway-specific CRISPR screens: Use libraries targeting cell cycle (e.g., Cyclin B1) and immune checkpoints (e.g., PD-L1).

  • Single-cell RNA-seq: Resolve tumor microenvironment heterogeneity (e.g., stromal vs. malignant cell NDC1 expression).

  • Organoid models: Validate tissue-specific effects using patient-derived HCC vs. pancreatic cancer organoids.

What experimental strategies validate NDC1 as a therapeutic target?

  • In vitro functional assays:

    • MTT/EdU proliferation: NDC1 knockdown reduces pancreatic cancer cell viability by 60% (IC50 = 12 µM) .

    • Transwell migration: NSCLC cell migration decreases by 75% post-siRNA treatment .

  • In vivo xenografts: NDC1-silenced NSCLC tumors show 50% volume reduction in nude mice .

  • Drug sensitivity profiling: NDC1-high pancreatic cancers exhibit resistance to gemcitabine (IC50 increase from 8 nM to 32 nM) .

Table 3: Functional Assays for NDC1 Validation

Assay TypeOutcome MetricExample ResultSource
siRNA knockdownG1 arrest (% cells)70% increase in NSCLC
Scratch assayMigration rate (µm/hr)0.25 vs. 0.75 (control)
Apoptosis (Annexin V)% apoptotic cells35% vs. 12% (control)

How does NDC1 influence the tumor immune microenvironment?

NDC1 expression correlates with immune evasion mechanisms:

  • TCGA immune deconvolution: Positive association with Tregs (ρ = 0.42) and M2 macrophages (ρ = 0.38) in HCC .

  • Immunotherapy response: NDC1-high tumors show reduced PD-1 inhibitor efficacy (ORR = 15% vs. 35% in NDC1-low) .

  • Cytokine profiling: IL-10 and TGF-β levels increase 2-fold in NDC1-overexpressing HCC cell supernatants .

Methodological approach:

  • Multiplex IHC: Co-stain for NDC1, CD8+ T cells, and PD-L1 in tumor sections.

  • CyTOF mass cytometry: Profile immune cell subsets in NDC1-silenced vs. control tumors.

Methodological Guidelines for Future Studies

  • Bioinformatics Workflows:

    • GSEA: Prioritize cell cycle (NES = 2.1, p < 0.001) and DNA repair pathways .

    • WGCNA: Identify co-expressed immune checkpoints (e.g., PD-L1, CTLA-4) .

  • Translational Models:

    • Use patient-derived xenografts (PDXs) with CRISPR-edited NDC1 alleles.

    • Test NDC1-targeted CAR-T cells in immune-competent murine models.

  • Data Reconciliation:

    • Apply meta-analysis frameworks (e.g., random-effects models) to harmonize pan-cancer vs. tissue-specific findings.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.