Recombinant Human Olfactory receptor 10A2 (OR10A2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it during order placement. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery times, please consult your local distributor.
Note: Our proteins are typically shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance. Additional fees may apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life depends on various factors such as storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, liquid formulations have a shelf life of 6 months at -20°C/-80°C. Lyophilized formulations have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize development accordingly.
Synonyms
OR10A2; OR10A2P; Olfactory receptor 10A2; HP4; Olfactory receptor OR11-86
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-303
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
OR10A2
Target Protein Sequence
MSFSSLPTEIQSLLFLTFLTIYLVTLMGNCLIILVTLADPMLHSPMYFFLRNLSFLEIGF NLVIVPKMLGTLLAQDTTISFLGCATQMYFFFFFGVAECFLLATMAYDRYVAICSPLHYP VIMNQRTRAKLAAASWFPGFPVATVQTTWLFSFPFCGTNKVNHFFCDSPPVLRLVCADTA LFEIYAIVGTILVVMIPCLLILCSYTHIAAAILKIPSAKGKNKAFSTCSSHLLVVSLFYI SLSLTYFRPKSNNSPEGKKLLSLSYTVMTPMLNPIIYSLRNNEVKNALSRTVSKALALRN CIP
Uniprot No.

Target Background

Function
Odorant receptor.
Gene References Into Functions
  1. Observational study of gene-disease association. (HuGE Navigator) PMID: 18446592
Database Links

HGNC: 8161

KEGG: hsa:341276

STRING: 9606.ENSP00000303862

UniGene: Hs.371762

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is OR10A2 and what is its functional classification?

OR10A2 is a protein encoded by the OR10A2 gene in humans. It belongs to the olfactory receptor family, which constitutes the largest gene family in the genome. Functionally, OR10A2 is classified as a G-protein-coupled receptor (GPCR) featuring the characteristic seven-transmembrane domain structure common to this receptor superfamily . Like other olfactory receptors, OR10A2 interacts with odorant molecules in the nasal epithelium to initiate neuronal responses that ultimately trigger smell perception .

The receptor is specifically designated as part of family 10, subfamily A, reflecting its evolutionary relationships within the olfactory receptor gene family. Alternative designations in research literature include OR10A2P, OR11-82, OR11-86, and OST363 . OR10A2 functions through G protein-mediated transduction of odorant signals, a mechanism shared across the olfactory receptor family .

How can recombinant OR10A2 be produced for experimental research?

Recombinant OR10A2 production follows similar methodologies to those established for other olfactory receptors. Based on comparable protocols for recombinant olfactory receptors, expression systems typically involve either wheat germ cell-free expression systems or heterologous expression in mammalian or insect cell lines .

For research-grade recombinant OR10A2, the methodology typically involves:

  • Gene synthesis or cloning: OR10A2 cDNA is synthesized or cloned into an appropriate expression vector with suitable purification tags (often His-tag or FLAG-tag).

  • Expression system selection: Wheat germ cell-free systems offer advantages for membrane proteins like OR10A2, as they avoid toxicity issues often encountered in bacterial systems .

  • Protein purification: Following expression, the protein is purified using affinity chromatography based on the incorporated tag.

  • Quality control: SDS-PAGE and Western blot analysis confirm protein identity and purity, similar to the validation methods used for other olfactory receptors .

When working with recombinant OR10A2, researchers should verify protein functionality through binding assays or functional reconstitution to ensure the recombinant form maintains native binding properties.

What experimental methods are most effective for studying OR10A2 binding properties?

Several complementary approaches can be employed to investigate OR10A2 binding properties:

  • Cell-based functional assays: Heterologous expression of OR10A2 in HEK293 cells coupled with calcium imaging or cAMP detection allows monitoring of receptor activation in response to potential ligands.

  • Competitive binding assays: Using labeled known ligands to assess displacement by test compounds provides insights into binding affinities.

  • Molecular docking studies: In silico approaches can predict the binding mode of odorants to OR10A2 based on homology models developed from related GPCRs .

  • Mutagenesis studies: Systematic mutation of predicted binding site residues followed by functional assays can identify critical amino acids involved in ligand recognition.

  • Protein-ligand interaction analysis: Surface plasmon resonance (SPR) or microscale thermophoresis can quantify binding kinetics between purified OR10A2 and potential ligands.

The most robust approach combines multiple methods, as each has inherent limitations. For instance, coupling molecular dynamics simulations with experimental validation provides more reliable insights into OR10A2 binding mechanisms than either approach alone .

What is known about the genetic variations in OR10A2 and their functional significance?

OR10A2, along with the nearby OR6A2 on chromosome 11, has been identified as a candidate gene associated with genetic variation in cilantro preference . This association suggests that polymorphisms in OR10A2 may influence how individuals perceive certain odorants.

The functional significance of OR10A2 genetic variations can be characterized through:

  • Genotype-phenotype correlation studies: Associating specific single nucleotide polymorphisms (SNPs) with sensory perception differences.

  • In vitro functional characterization: Comparing the odorant response profiles of different OR10A2 variants in cellular assays.

  • Population genetics analysis: Examining the frequency and distribution of OR10A2 variants across different populations to identify patterns of selection.

Studies on OR10A2 variants provide valuable insights into the molecular basis of individual differences in odor perception, with potential applications in personalized food preference research and sensory science.

How can molecular dynamics simulations be applied to study OR10A2 binding mechanisms?

Molecular dynamics (MD) simulations offer powerful approaches for investigating OR10A2 binding mechanisms at the atomic level. The methodology involves:

  • Structure preparation: Since no crystallographic structure of OR10A2 exists, researchers typically begin with homology modeling based on related GPCRs or utilize AI-powered structure prediction tools like AlphaFold2 .

  • System setup: The OR10A2 model is embedded in a lipid bilayer mimicking the cellular membrane, solvated with explicit water molecules, and ionized to physiological conditions.

  • Simulation parameters: Appropriate force fields (e.g., CHARMM36 or AMBER) are selected, and the system is equilibrated before production runs.

  • Binding site analysis: MD simulations can identify conformational changes upon ligand binding, revealing how OR10A2 accommodates different odorants.

  • Binding free energy calculations: Methods such as MM/PBSA or umbrella sampling can quantify the energetics of OR10A2-ligand interactions.

Recent advances in this field have demonstrated the value of combining AlphaFold2's protein structure prediction with MD simulations to elucidate binding mechanisms in olfactory receptors . For example, research on related ORs has revealed that structural alterations in extracellular loops (particularly ECL3) play crucial roles in receptor activation upon odorant binding .

When applying MD to OR10A2, researchers should focus on:

  • Identifying the volume and shape of the binding pocket

  • Characterizing key residues involved in ligand recognition

  • Determining the conformational changes associated with receptor activation

What are the specificity determining residues (SDRs) in OR10A2 and how do they influence odor recognition?

Specificity determining residues (SDRs) are critical amino acid positions that define the odorant recognition profile of olfactory receptors. Although the specific SDRs for OR10A2 have not been conclusively identified in the provided search results, the methodology for SDR determination can be applied to OR10A2:

  • Evolutionary analysis: SDRs are typically more conserved among orthologs (assumed to have similar binding spectra) than among paralogs (assumed to have divergent binding spectra) .

  • Sequence-based prediction: Computational approaches can identify putative SDRs by comparing sequence conservation patterns across multiple OR proteins .

  • Homology modeling: Structural models of OR10A2 based on related GPCRs can highlight residues likely to form the binding pocket.

Based on studies of other olfactory receptors, approximately 22 SDRs typically form the odorant binding site . For OR10A2, these residues would be expected to:

  • Be located within the transmembrane regions facing the central binding pocket

  • Show chemical properties compatible with ligand interaction

  • Exhibit evolutionary patterns consistent with functional specialization

The influence of SDRs on OR10A2 function can be experimentally validated through site-directed mutagenesis followed by functional assays. Mutations of critical SDRs would be expected to alter the receptor's response profile to odorants, particularly those associated with cilantro perception given OR10A2's potential role in cilantro preference .

How can computational approaches be integrated with experimental methods to deorphanize OR10A2?

Deorphanization—identifying the natural ligands that activate an orphan receptor—remains a significant challenge for many olfactory receptors including OR10A2. An integrated approach combining computational and experimental methods offers the most promising strategy:

  • Virtual screening and molecular docking: Using homology models of OR10A2, researchers can virtually screen libraries of odorant molecules to identify potential ligands based on predicted binding energies and interactions .

  • Machine learning approaches: Protein Chemistry Metric (PCM) models that integrate receptor sequence information with ligand physicochemical properties can predict OR10A2 responses to untested odorants with relative accuracy .

  • High-throughput screening: Experimental validation of computationally predicted ligands using cell-based assays where OR10A2 is heterologously expressed.

  • Structure-activity relationship (SAR) analysis: Systematic testing of structurally related compounds can define the chemical features required for OR10A2 activation.

Recent research has demonstrated that PCM models achieve approximately 58% success rates in predicting novel odorant-OR pairs, while molecular docking combined with virtual screening has shown impressive 70% success rates in identifying novel ligands for other olfactory receptors .

Table 1. Comparison of Deorphanization Approaches for Olfactory Receptors

MethodAdvantagesLimitationsReported Success Rate
PCM ModelsCan predict responses based on limited sequence dataRequires training data from related ORs~58%
Molecular DockingProvides structural insights into binding modeDepends on accuracy of homology model~70% when combined with virtual screening
High-throughput ScreeningDirect experimental validationResource-intensive, limited compound librariesVariable
Functional ExpressionDefinitive confirmation of ligand-receptor interactionTechnical challenges in OR expressionGold standard for validation

What challenges exist in expressing functional recombinant OR10A2 for structural studies?

Structural studies of OR10A2 face several significant challenges that are common to many olfactory receptors:

  • Low expression levels: Like other GPCRs, olfactory receptors typically express poorly in heterologous systems due to their hydrophobic nature and tendency to misfold.

  • Protein instability: The seven-transmembrane structure requires specific membrane environments to maintain stability and native conformation.

  • Conformational heterogeneity: ORs may adopt multiple conformations, complicating structural studies that require homogeneous samples.

  • Purification difficulties: Extracting sufficient quantities of functional protein from expression systems while maintaining native folding presents technical challenges.

To overcome these obstacles, researchers have developed several strategies that could be applied to OR10A2:

  • Expression system optimization: Wheat germ cell-free systems have shown promise for expressing olfactory receptor fragments , while insect cell lines may better support full-length receptor expression.

  • Fusion protein approaches: Creating fusion constructs with proteins known to enhance membrane protein expression and stability (e.g., T4 lysozyme, BRIL).

  • Thermostabilizing mutations: Introducing mutations that increase protein thermostability without affecting function.

  • Nanobody or antibody co-crystallization: Using these binding partners to stabilize specific receptor conformations.

  • Advanced structural biology techniques: Cryo-electron microscopy has recently enabled breakthrough structures of human olfactory receptors and may be suitable for OR10A2 .

Recent successes in obtaining structures of related olfactory receptors, such as OR51E2 (which recognizes propionic acid found in cheese aromas), demonstrate that these technical hurdles can be overcome with persistent optimization and innovative approaches .

How do the binding mechanisms of OR10A2 compare with other characterized olfactory receptors?

Understanding how OR10A2 binding mechanisms compare with other characterized olfactory receptors provides valuable insights into the principles of odorant recognition. While specific OR10A2 binding data is limited in the search results, comparative analysis can be inferred from studies of related receptors:

  • Binding pocket characteristics: Recent structural studies of human OR51E2 revealed a compact enclosed binding pocket measuring only 31 ų, which selectively accommodates short-chain fatty acids . The binding pocket size of OR10A2 might similarly determine its ligand selectivity.

  • Types of molecular interactions: OR51E2 engages in both polar interactions (hydrogen and ionic bonds) and non-specific hydrophobic interactions with its odorant ligands . OR10A2 likely employs similar interaction types, though the specific pattern would reflect its ligand preferences.

  • Activation mechanisms: Structural changes in extracellular loops, particularly ECL3, have been identified as crucial for receptor activation in some ORs . These structural elements may also be important in OR10A2 function.

Table 2. Comparison of Binding Properties Across Selected Olfactory Receptors

Olfactory ReceptorKnown LigandsBinding Pocket FeaturesKey Binding InteractionsRef
OR51E2Propionic acid (cheese aroma)Compact (31 ų), enclosedPolar and hydrophobic interactions
OR10G3Vanillin, ethyl vanillinNot fully characterizedNot fully characterized
OR10G4Guaiacol, vanillin, ethyl vanillin, quinoline, coumarinNot fully characterizedNot fully characterized
OR10A3Suberic acidNot fully characterizedNot fully characterized
OR10A2Potentially cilantro-related compoundsRequires characterizationRequires characterization

OR10A2's proposed role in cilantro preference suggests it may recognize specific compounds in cilantro, possibly aldehydes like (E)-2-decenal or (E)-2-dodecenal that contribute to cilantro's distinctive aroma. Comparative analysis with other characterized ORs provides a framework for predicting OR10A2's binding mechanisms.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.