Recombinant Human Olfactory receptor 10A5 (OR10A5)

Shipped with Ice Packs
In Stock

Description

Production and Purification Methods

Recombinant OR10A5 is produced via heterologous expression systems:

Expression Systems

SystemDetails
Cell-freeUsed in MyBioSource’s product (MBS7024653), enabling controlled protein folding .
E. coliCusabio’s product (CSB-CF880948HU) employs bacterial expression for high yield, tagged with N-terminal 10xHis for purification .

Purification Steps

  1. Immunoaffinity chromatography: Utilizes FLAG or His-tag affinity to isolate tagged OR10A5 .

  2. Gel filtration: Separates monomeric and dimeric forms, as observed in related olfactory receptors .

  3. Quality control: Circular dichroism (CD) spectroscopy confirms proper folding .

Ligand Interaction Studies

While OR10A5’s physiological ligands are unknown, recombinant versions are used to investigate:

  • Odorant binding affinity: Fluorescence assays (e.g., intrinsic tryptophan fluorescence) measure ligand interactions, though micromolar affinities are typical for ORs .

  • Metalloprotein hypotheses: Proposed copper/zinc coordination in odorant recognition, though not confirmed for OR10A5 .

Research Challenges and Future Directions

  • Ligand Discovery: Limited by the absence of known agonists/antagonists .

  • Structural Complexity: Dimerization and membrane integration complicate crystallization .

  • Therapeutic Potential: Insights into olfactory disorders or neurodegenerative diseases linked to OR dysfunction .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional fees.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
OR10A5; OR10A1; Olfactory receptor 10A5; HP3; Olfactory receptor 10A1; Olfactory receptor 11-403; OR11-403; Olfactory receptor-like protein JCG6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-317
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
OR10A5
Target Protein Sequence
MAIGNWTEISEFILMSFSSLPTEIQSLLFLTFLTIYLVTLKGNSLIILVTLADPMLHSPM YFFLRNLSFLEIGFNLVIVPKMLGTLLAQDTTISFLGCATQMYFFFFFGVAECFLLATMA YDRYVAICSPLHYPVIMNQRTRAKLAAASWFPGFPVATVQTTWLFSFPFCGTNKVNHFFC DSPPVLKLVCADTALFEIYAIVGTILVVMIPCLLILCSYTRIAAAILKIPSAKGKHKAFS TCSSHLLVVSLFYISSSLTYFWPKSNNSPESKKLLSLSYTVVTPMLNPIIYSLRNSEVKN ALSRTFHKVLALRNCIP
Uniprot No.

Target Background

Function
Odorant receptor (potential). May be involved in taste perception.
Database Links

HGNC: 15131

OMIM: 608493

KEGG: hsa:144124

STRING: 9606.ENSP00000299454

UniGene: Hs.447478

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in the tongue.

Q&A

What are olfactory receptors and how are they classified?

Olfactory receptors (ORs) are specialized proteins that detect odorant molecules in the environment. They belong to class A G-protein-coupled receptors (GPCRs) and constitute the largest transmembrane protein family in the human genome . Functionally, ORs can be classified into groups that respond to a broad range of odorants and those activated by a limited number of related odorants .

Structurally, olfactory receptors belong to the G-protein coupled receptor 1 family . This classification is based on their molecular architecture and signaling mechanisms. The functional diversity of ORs allows for the detection of numerous odorant molecules, contributing to the remarkable complexity of human olfactory perception.

What is the general structure of human olfactory receptors?

Human olfactory receptors are transmembrane proteins with structural characteristics typical of G-protein coupled receptors. Based on available data for olfactory receptor 10X1, they consist of a full-length protein of approximately 309 amino acids . The primary sequence reveals the characteristic GPCR structure with seven transmembrane domains connected by intracellular and extracellular loops.

The amino acid sequence of olfactory receptors contains specific binding domains for odorant molecules and interaction sites for G-proteins that mediate signal transduction. For experimental applications, these receptors can be engineered with epitope tags (such as C-terminal rho1D4 and N-terminal FLAG) to facilitate purification and detection in laboratory settings .

How are olfactory receptors expressed in non-olfactory tissues?

Contrary to traditional understanding, olfactory receptors exhibit ectopic expression in various non-chemosensory tissues. Research has demonstrated that ORs are expressed in tissues including muscle, kidney, and keratinocytes, though their physiological roles in these contexts remain largely unexplored .

Specific studies have identified human olfactory receptor OR10J5 expression in the human aorta, coronary artery, and umbilical vein endothelial cells (HUVEC) . This ectopic expression pattern suggests that olfactory receptors may serve functions beyond their well-established role in olfaction, potentially participating in various physiological processes throughout the body.

What techniques are most effective for studying olfactory receptor expression patterns?

RNA-Seq technology has revolutionized quantitative expression profiling of olfactory receptors. This advanced technique has contributed substantially to understanding ectopically expressed ORs in diverse human tissues . The relative abundance of transcripts can be quantified using metrics such as FPKM (fragments per kilobase of exon per million fragments mapped) .

For visualization and analysis of RNA-Seq data, tools like the Integrative Genomic Viewer can effectively analyze read distribution patterns . Statistical analysis of expression data should be conducted based on data distribution characteristics - normally distributed data can be analyzed using Student's t-test, while non-parametric tests like Mann-Whitney or Kruskal-Wallis are appropriate for data that doesn't follow normal distribution .

What experimental systems are suitable for studying recombinant olfactory receptors?

Recombinant olfactory receptors can be studied using heterologous expression systems. A particularly effective approach involves overexpressing the target receptor in a stable tetracycline-inducible cell line such as HEK293S . This method allows for controlled expression of the receptor and facilitates subsequent purification and characterization.

For production of recombinant olfactory receptor proteins, wheat germ expression systems have proven successful, yielding proteins suitable for techniques such as ELISA and Western Blotting . These expression systems provide valuable platforms for investigating the structural and functional properties of olfactory receptors in controlled experimental conditions.

How can recombinant human olfactory receptors be expressed and purified for functional studies?

Expression and purification of recombinant human olfactory receptors require sophisticated techniques for successful implementation. The recommended approach involves overexpressing the receptor in a stable tetracycline-inducible cell line such as HEK293S . For optimal results, the receptor should be engineered with epitope tags to facilitate purification and detection - for example, the human OR hOR1A1 has been successfully tagged with C-terminal rho1D4 and N-terminal FLAG epitopes .

A two-step purification process has proven effective for isolating detergent-solubilized receptors:

  • Monoclonal anti-FLAG immunoaffinity purification

  • Gel filtration chromatography

What methods can be used to characterize the ligand-binding properties of olfactory receptors?

Characterizing ligand-binding properties of olfactory receptors requires specialized biophysical techniques. Intrinsic tryptophan fluorescence assay has proven effective for quantifying ligand binding, as demonstrated with detergent-solubilized FLAG-rho1D4-tagged hOR1A1, which was shown to bind its cognate odorant, dihydrojasmone, with micromolar affinity .

For comprehensive characterization, researchers should consider:

  • Determining binding kinetics and affinity constants using dose-response curves

  • Assessing binding specificity by testing structurally related compounds

  • Evaluating the effects of mutations in putative binding sites

These approaches provide critical insights into the molecular mechanisms of odorant recognition and can guide structure-function analyses for understanding receptor specificity determinants.

How do olfactory receptors contribute to physiological processes beyond olfaction?

Research has revealed significant roles for olfactory receptors in non-olfactory physiological processes. OR10J5, expressed in human vascular endothelial cells, has been implicated in angiogenesis through several mechanisms:

  • Stimulation with lyral induces Ca²⁺ mobilization and AKT phosphorylation in HUVEC cells

  • These processes are inhibited when OR10J5 is knocked down by RNAi

  • Lyral enhances HUVEC migration in vitro

  • Matrigel plug assays demonstrate that lyral enhances angiogenesis in vivo

These findings collectively demonstrate that OR10J5 plays a physiological role in angiogenesis regulation, highlighting the diverse functions of olfactory receptors beyond their canonical sensory roles . This expanding understanding of olfactory receptor function suggests potential applications in therapeutic development for vascular conditions.

What approaches are most effective for identifying novel ligands for specific olfactory receptors?

Identifying novel ligands for specific olfactory receptors requires a multidisciplinary approach combining computational and experimental methods. Effective strategies include:

  • High-throughput screening of chemical libraries against heterologously expressed receptors

  • Functional calcium imaging or cAMP assays to detect receptor activation

  • Validation through concentration-response relationships

  • Confirmation of specificity using receptor knockdown approaches

The binding of ligands should be quantified using biophysical techniques such as intrinsic tryptophan fluorescence assays, which have successfully demonstrated the interaction between hOR1A1 and dihydrojasmone . Structure-activity relationship studies comparing responses to structurally related compounds can provide insights into the molecular determinants of receptor activation.

How can olfactory receptors serve as biomarkers in cancer research?

Olfactory receptors have emerged as potential biomarkers in cancer research, particularly in the context of breast carcinoma . RNA-Seq analysis of cancer tissues has revealed distinct expression patterns of olfactory receptors that may correlate with disease states or progression.

The development of RNA-Seq technology has enabled thorough quantitative expression profiling of ectopically expressed ORs in diverse human tissues, including cancer tissues . Researchers can leverage publicly available transcriptome datasets from repositories like the SRA archive to analyze OR expression patterns across different cancer types and stages .

To utilize ORs as effective biomarkers, researchers should:

  • Compare expression levels between tumor and matched normal tissues

  • Correlate expression with clinical parameters and outcomes

  • Validate findings using orthogonal techniques like qPCR or immunohistochemistry

  • Investigate functional consequences of altered OR expression

How should experiments be designed to study olfactory receptor signaling pathways?

Designing experiments to study olfactory receptor signaling pathways requires careful consideration of multiple factors to ensure robust and reproducible results. A comprehensive experimental design should include:

  • Selection of appropriate cell models expressing the receptor of interest

  • Validation of receptor expression using quantitative PCR and Western blotting

  • Implementation of real-time signaling assays, such as calcium imaging or cAMP measurements

  • Inclusion of appropriate positive and negative controls

  • Receptor knockdown experiments to confirm specificity of observed effects

Researchers studying OR10J5 have successfully implemented this approach by:

  • Confirming receptor expression in HUVEC cells

  • Measuring calcium mobilization and AKT phosphorylation following lyral stimulation

  • Performing knockdown studies to demonstrate that these responses are mediated by OR10J5

Time-course experiments should be included to distinguish between immediate and delayed effects, providing insights into the sequence of signaling events following receptor activation.

What are the critical considerations for RNA-Seq analysis of olfactory receptor expression?

RNA-Seq analysis of olfactory receptor expression requires attention to several critical factors to generate reliable and interpretable data:

  • Sample preparation and sequencing depth must be standardized across comparison groups

  • Proper quantification methods should be employed, such as using Cufflinks with FPKM metrics

  • Visualization tools like Integrative Genomic Viewer should be used for analyzing read distribution

  • Statistical analysis must be appropriate to the data distribution:

    • For normally distributed data: two-tailed unpaired Student's t-test

    • For non-normally distributed data: Mann-Whitney test or Kruskal-Wallis one-way analysis of variance

When analyzing public data from repositories like SRA, researchers should ensure consistent bioinformatic pipelines are applied across all datasets to minimize technical variability that could confound biological interpretation .

How can functional assays be optimized for studying olfactory receptor activity?

Optimizing functional assays for studying olfactory receptor activity requires consideration of several key parameters:

  • Selection of appropriate cellular readouts based on known signaling pathways:

    • Second messenger assays (cAMP, Ca²⁺)

    • Protein phosphorylation (e.g., AKT phosphorylation for OR10J5)

    • Functional cellular responses (migration, proliferation)

  • Assay sensitivity and dynamic range optimization:

    • Determine optimal cell density and receptor expression levels

    • Establish dose-response relationships with reference ligands

    • Minimize background signals through appropriate controls

  • Temporal considerations:

    • Determine optimal time points for measuring different signaling events

    • Perform time-course experiments to characterize signaling kinetics

For studying OR10J5 in endothelial cells, migration assays have proven particularly informative, revealing that lyral enhances HUVEC migration - an effect that can be abolished by receptor knockdown .

What controls are essential when studying ectopically expressed olfactory receptors?

When studying ectopically expressed olfactory receptors, several essential controls must be incorporated to ensure experimental validity:

  • Expression validation controls:

    • Quantitative PCR to confirm receptor mRNA expression

    • Western blotting or immunofluorescence to verify protein expression

    • Empty vector transfection as negative control

  • Functional specificity controls:

    • Receptor knockdown using siRNA or shRNA to confirm observed effects are receptor-dependent

    • Testing structurally related compounds to assess ligand specificity

    • Use of receptor antagonists when available

  • Signal transduction controls:

    • Positive controls using known activators of downstream pathways

    • Pathway inhibitors to confirm involvement of specific signaling components

These controls are exemplified in studies of OR10J5, where siRNA knockdown was used to demonstrate that lyral-induced Ca²⁺ mobilization, AKT phosphorylation, and enhanced HUVEC migration are specifically mediated by this receptor .

How can in vitro findings on olfactory receptors be validated in physiologically relevant contexts?

Validating in vitro findings on olfactory receptors in physiologically relevant contexts requires a systematic approach bridging cellular models and in vivo systems:

  • Transition from cell lines to primary cells:

    • Confirm receptor expression in primary cells from relevant tissues

    • Validate functional responses in these primary cells

  • Ex vivo tissue models:

    • Tissue explants or organoids to assess receptor function in a more complex cellular environment

    • Preservation of tissue architecture and cell-cell interactions

  • In vivo validation approaches:

    • Matrigel plug assays for angiogenesis studies, as used for OR10J5

    • Genetic models with receptor knockout or overexpression

    • Localized administration of receptor ligands

  • Correlation with human physiological or pathological conditions:

    • Analysis of receptor expression in human tissue samples

    • Association of expression patterns with disease states or physiological parameters

This multifaceted validation approach ensures that findings have physiological relevance beyond simplified in vitro models.

How should researchers approach conflicting data on olfactory receptor function?

When confronted with conflicting data on olfactory receptor function, researchers should implement a systematic approach to reconciliation:

  • Methodological comparison:

    • Evaluate differences in experimental systems (cell types, expression methods)

    • Compare assay sensitivities and readouts

    • Assess potential confounding factors in each study design

  • Receptor expression level considerations:

    • Determine whether expression levels differ between studies

    • Consider potential artifacts from overexpression systems

    • Evaluate physiological relevance of expression levels

  • Sequence verification:

    • Confirm identity of receptor being studied (polymorphisms, splice variants)

    • Verify presence and position of epitope tags that might affect function

  • Independent validation:

    • Replicate key experiments under standardized conditions

    • Use alternative methodologies to assess the same functional parameters

    • Consider collaborative cross-laboratory validation

This systematic approach helps distinguish genuine biological complexity from methodological artifacts in the study of olfactory receptor function.

What statistical approaches are most appropriate for analyzing olfactory receptor data?

Selection of appropriate statistical approaches for olfactory receptor data depends on experimental design and data characteristics:

  • Data distribution assessment:

    • All results should first be tested for normality using Shapiro-Wilk test

    • Equal variance should be verified prior to parametric testing

  • Appropriate statistical tests:

    • For normally distributed data: two-tailed unpaired Student's t-test

    • For non-normally distributed data: Mann-Whitney test or Kruskal-Wallis one-way analysis of variance

  • Significance reporting conventions:

      • p < 0.05

    • ** p < 0.01

    • *** p < 0.001

  • Multiple testing considerations:

    • Apply appropriate corrections (Bonferroni, Benjamini-Hochberg) when conducting multiple comparisons

    • Consider false discovery rate control for genome-wide expression analyses

These approaches ensure rigorous statistical analysis of olfactory receptor data, enhancing reproducibility and reliability of research findings.

How can structure-activity relationships be determined for olfactory receptor ligands?

Determining structure-activity relationships for olfactory receptor ligands requires a methodical approach combining experimental and computational techniques:

  • Systematic chemical variation:

    • Test series of structurally related compounds

    • Modify specific chemical moieties to identify essential features

    • Quantify responses using functional assays (calcium imaging, cAMP)

  • Binding studies:

    • Use intrinsic tryptophan fluorescence assays to quantify binding

    • Determine binding affinities for different structural analogs

    • Competitive binding studies to identify binding site overlaps

  • Computational modeling:

    • Homology modeling based on related GPCR structures

    • Molecular docking simulations to predict binding modes

    • Molecular dynamics to evaluate stability of receptor-ligand complexes

  • Validation through mutagenesis:

    • Target residues predicted to interact with ligands

    • Evaluate effects of mutations on binding affinity and functional responses

    • Identify key interaction points within the receptor binding pocket

This integrated approach provides comprehensive insights into the molecular determinants of ligand recognition and receptor activation.

What bioinformatic tools are most valuable for olfactory receptor research?

Several bioinformatic tools have proven particularly valuable for olfactory receptor research:

  • Sequence analysis tools:

    • Multiple sequence alignment for evolutionary analysis

    • Transmembrane domain prediction for structural modeling

    • Phylogenetic analysis software for receptor classification

  • Expression analysis platforms:

    • Cufflinks for RNA-Seq quantification using FPKM metrics

    • Integrative Genomic Viewer for analyzing read distribution

    • DESeq2 or edgeR for differential expression analysis

  • Structural prediction tools:

    • GPCR-specific homology modeling servers

    • Molecular docking software for ligand binding prediction

    • Molecular dynamics simulation packages

  • Systems biology approaches:

    • Pathway analysis tools for identifying signaling networks

    • Protein-protein interaction databases for identifying potential partners

    • Gene set enrichment analysis for functional interpretation

Effective integration of these bioinformatic tools provides a comprehensive framework for investigating olfactory receptor biology from sequence to function.

How should researchers interpret olfactory receptor expression in disease contexts?

Interpreting olfactory receptor expression in disease contexts requires careful consideration of multiple factors:

  • Expression level analysis:

    • Compare receptor expression between diseased and normal tissues

    • Consider fold changes and absolute expression levels

    • Evaluate consistency across multiple patient samples

  • Causality assessment:

    • Determine whether altered expression is cause or consequence of disease

    • Evaluate correlation with disease progression or severity

    • Consider potential confounding factors (medication, environmental factors)

  • Functional relevance:

    • Investigate consequences of altered expression through in vitro models

    • Determine whether receptor activation affects disease-relevant pathways

    • Evaluate potential as therapeutic target or biomarker

  • Validation in independent cohorts:

    • Confirm findings across different patient populations

    • Use alternative methodologies (qPCR, immunohistochemistry)

    • Consider meta-analysis when multiple datasets are available

This systematic approach helps distinguish clinically relevant alterations from incidental findings, guiding the translation of basic research into clinical applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.