Recombinant Human Olfactory receptor 10C1 (OR10C1)

Shipped with Ice Packs
In Stock

Description

Introduction to Olfactory Receptor 10C1

Olfactory receptor 10C1 (OR10C1) is a member of the G-protein-coupled receptor (GPCR) superfamily that originates from single coding-exon genes . These receptors are fundamental components of the olfactory system, responsible for the recognition and transduction of odorant signals through G protein-mediated pathways . OR10C1 specifically belongs to the family 10, subfamily C of olfactory receptors, and is also known by several synonyms including Hs6M1-17, OR10C1P, Olfactory receptor 10C2, Olfactory receptor OR6-31, OR10C2, and OR6-31 .

The human olfactory system relies on approximately 400 different olfactory receptors to enable the sense of smell, allowing for the detection and discrimination of countless odors in our environment . These receptors function as molecular sensors that interact with odorant molecules in the nasal epithelium, initiating the complex neuronal pathways that ultimately result in odor perception . Understanding the structure and function of individual receptors like OR10C1 provides valuable insights into the mechanisms of olfaction and sensory processing.

Recombinant versions of OR10C1 are engineered forms of the natural protein produced through molecular biology techniques, allowing for controlled expression and isolation of the receptor for research purposes . These recombinant proteins serve as important tools for investigating receptor-ligand interactions, structural characteristics, and functional properties of OR10C1 without the complexities associated with extracting the native protein from biological tissues.

Transmembrane Architecture

OR10C1, like other olfactory receptors, exhibits a characteristic 7-transmembrane domain structure that is common among G-protein-coupled receptors . This structural arrangement consists of seven alpha-helical segments that span the cell membrane, connected by alternating intracellular and extracellular loops. The transmembrane domains create a binding pocket where odorant molecules can interact with the receptor, triggering conformational changes that initiate signal transduction.

The structural similarity between OR10C1 and other neurotransmitter and hormone receptors reflects their shared evolutionary origins and functional mechanisms . These structural features are highly conserved across species, with OR10C1 showing significant sequence identity with orthologs in other mammals, including 89% identity with both mouse and rat variants .

Ligand Binding Sites

The precise three-dimensional structure of OR10C1's ligand binding pocket remains an active area of research. Recent advances in structural biology, particularly the development of consensus olfactory receptors (consORs), have provided valuable templates for modeling individual native ORs, including OR10C1 . These models suggest that the binding pocket is formed primarily by the transmembrane domains, with specific amino acid residues contributing to ligand recognition and selectivity.

The binding pocket of OR10C1 likely accommodates a range of odorant molecules, though the specific chemical features that determine ligand affinity and receptor activation are still being elucidated. Understanding these structure-function relationships is essential for predicting OR10C1's response properties and developing targeted modulators of receptor activity.

Olfactory Signal Transduction

OR10C1 functions within the olfactory signal transduction pathway, where it plays a crucial role in converting chemical signals from odorant molecules into electrical signals that can be processed by the brain . When an odorant molecule binds to OR10C1, it triggers a conformational change in the receptor, activating associated G proteins. This activation initiates a cascade of intracellular signaling events, ultimately leading to the generation of action potentials in olfactory sensory neurons.

The specificity of OR10C1 for particular odorant molecules contributes to the discriminatory power of the olfactory system. Each olfactory receptor responds to a subset of odorants with varying affinities, creating a combinatorial code that allows for the perception of countless different smells from a limited number of receptors . OR10C1's contribution to this code depends on its unique binding properties and expression pattern within the olfactory epithelium.

Classification and Receptor Family

Olfactory receptors can be broadly categorized into two main classes: class I ORs, which are primarily tuned to carboxylic acids, and class II ORs, which respond to a wider variety of odorants . While the specific classification of OR10C1 is not explicitly stated in the available information, its placement within family 10, subfamily C suggests certain functional characteristics that distinguish it from other olfactory receptor subfamilies.

The olfactory receptor gene family, to which OR10C1 belongs, is the largest gene family in the human genome . This extensive diversity reflects the importance of olfaction throughout evolutionary history and the need for organisms to detect and discriminate between a vast array of environmental chemicals. The nomenclature system for these receptors is organism-specific, allowing for precise identification and classification of receptors across different species .

Environmental Chemical Effects on OR10C1 Expression

Research on OR10C1 orthologs in other species, particularly in rats, has revealed numerous gene-chemical interactions that affect the expression and methylation status of the receptor . These interactions provide valuable insights into how environmental factors might influence olfactory receptor function and, consequently, olfactory perception.

Table 1: Chemical Compounds Affecting OR10C1 Expression

Chemical CompoundEffect on OR10C1Species StudiedReference ID
4,4'-diaminodiphenylmethaneIncreases expressionRat (based on mouse data)PMID:18648102
C60 fullereneIncreases expressionRatPMID:19167457
Folic acidIncreases expressionRat (based on mouse data)PMID:25629700
Potassium dichromateDecreases expressionRat (based on mouse data)PMID:23608068

These findings suggest that OR10C1 expression is responsive to environmental chemicals, potentially affecting olfactory sensitivity and specificity. The increase in expression observed with compounds like folic acid and C60 fullerene might enhance receptor availability, while the decrease seen with potassium dichromate could potentially reduce olfactory sensitivity to OR10C1-specific odorants .

Epigenetic Modifications of OR10C1

Beyond direct effects on expression levels, several compounds have been shown to influence the epigenetic regulation of OR10C1 through changes in DNA methylation . Methylation patterns can significantly impact gene expression, potentially altering the receptor's developmental trajectory and functional properties.

Table 2: Chemical Compounds Affecting OR10C1 Methylation

Chemical CompoundEffect on OR10C1 MethylationSpecies StudiedReference ID
Benzo[a]pyreneIncreases promoter methylationRat (based on human data)PMID:27901495
Benzo[a]pyreneAffects exon methylationRat (based on human data)PMID:27901495
Cadmium dichlorideDecreases promoter methylationRatPMID:22457795
OzoneAffects methylationRat (based on human data)PMID:35835166

These epigenetic modifications may have long-term consequences for OR10C1 function, potentially contributing to altered olfactory perception in response to environmental exposures. The opposing effects of different compounds on methylation status highlight the complex regulatory mechanisms governing olfactory receptor expression and function .

Recombinant Protein Variants

Recombinant forms of OR10C1 provide valuable tools for studying the receptor's properties and functions in controlled laboratory settings. One specific variant is the Human OR10C1 (aa 170-196) Control Fragment Recombinant Protein, which represents a portion of the full-length receptor . This fragment can be used in blocking experiments with corresponding antibodies, particularly in immunohistochemistry/immunocytochemistry (IHC/ICC) and Western blot (WB) applications .

For optimal results in blocking experiments, a 100x molar excess of the recombinant protein fragment is recommended . This approach helps validate antibody specificity by competing for binding sites, confirming that observed signals are due to specific recognition of the target protein rather than non-specific interactions.

Engineered Olfactory Receptors

Recent advances in protein engineering have led to the development of consensus olfactory receptors (consORs), which are designed based on shared sequence features across major subfamilies of human ORs . While not specific to OR10C1, these engineered receptors provide valuable templates for understanding the structural and functional properties of individual native receptors, including OR10C1.

The biochemical tractability of consORs has enabled significant breakthroughs in structural biology, including the determination of cryogenic electron microscopy structures for several receptor variants . These structures reveal distinct modes of odorant binding and activation mechanisms among different receptor classes, providing a framework for understanding how OR10C1 might interact with its specific ligands.

Sequence Conservation

OR10C1 exhibits significant sequence conservation across mammalian species, with human OR10C1 showing 89% sequence identity with both mouse and rat orthologs in specific regions . This high degree of conservation suggests that the receptor's function is evolutionarily important and subject to selective pressure that maintains structural and functional integrity across species.

The conservation of sequence identity is particularly notable given the rapid evolution and diversification typically observed in olfactory receptor genes. This suggests that OR10C1 may detect odorants that have been consistently relevant throughout mammalian evolution, potentially including compounds associated with food, predators, or social interactions.

Functional Differences

Despite the high sequence similarity, subtle differences in amino acid composition between species may lead to functional variations in ligand specificity and receptor dynamics. These differences could reflect adaptations to species-specific ecological niches and olfactory requirements. Comparative studies of OR10C1 across species provide opportunities to investigate how evolutionary pressures have shaped olfactory perception in different lineages.

Research on rat OR10C1 has revealed numerous interactions with environmental chemicals that affect gene expression and methylation status . These findings provide a foundation for investigating whether similar interactions occur with human OR10C1, potentially influencing human olfactory perception in response to environmental exposures.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that we have in stock. However, if you have specific requirements for the format, please indicate them in your order remarks. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery timeframes.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please communicate with us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For short-term storage, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
OR10C1; OR10C2; Olfactory receptor 10C1; Hs6M1-17; Olfactory receptor 10C2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-312
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
OR10C1
Target Protein Sequence
MSANTSMVTEFLLLGFSHLADLQGLLFSVFLTIYLLTVAGNFLIVVLVSTDAALQSPMYF FLRTLSALEIGYTSVTVPLLLHHLLTGRRHISRSGCALQMFFFLFFGATECCLLAAMAYD RYAAICEPLRYPLLLSHRVCLQLAGSAWACGVLVGLGHTPFIFSLPFCGPNTIPQFFCEI QPVLQLVCGDTSLNELQIILATALLILCPFGLILGSYGRILVTIFRIPSVAGRRKAFSTC SSHLIMVSLFYGTALFIYIRPKASYDPATDPLVSLFYAVVTPILNPIIYSLRNTEVKAAL KRTIQKTVPMEI
Uniprot No.

Target Background

Function
Odorant receptor.
Gene References Into Functions
  1. Observational study of gene-disease association. (HuGE Navigator) PMID: 19833159
Database Links

HGNC: 8165

KEGG: hsa:442194

STRING: 9606.ENSP00000419119

UniGene: Hs.631997

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Recombinant Human Olfactory Receptor 10C1?

Recombinant Human Olfactory Receptor 10C1 (OR10C1) is a member of the olfactory receptor family, belonging to the G-protein coupled receptor 1 family. These receptors are expressed primarily in the olfactory epithelium and function as odorant receptors, detecting specific chemical compounds and initiating signal transduction cascades that ultimately result in odor perception. Unlike natural receptor proteins, recombinant OR10C1 is artificially produced using molecular biology techniques to express the human OR10C1 gene in heterologous expression systems. This approach allows researchers to study the receptor's properties in controlled laboratory conditions, essential for understanding its structural features, ligand interactions, and signaling mechanisms.

How does OR10C1 differ from other olfactory receptors in the OR10 family?

OR10C1 belongs to the olfactory receptor family 10, subfamily C, which distinguishes it from other OR10 subfamily members such as OR10X1. While they share structural similarities as G-protein coupled receptors, they differ in their amino acid sequences, which influences their ligand specificity and binding characteristics . These amino acid differences primarily occur in the transmembrane domains that form the ligand-binding pocket, resulting in distinct odorant recognition profiles. The OR10 family members also demonstrate different expression patterns and may be regulated by distinct mechanisms. Understanding these differences is crucial for researchers designing selective experiments, as cross-reactivity with similar receptors can confound results when investigating OR10C1-specific functions.

What are the key structural features of recombinant OR10C1 protein?

Recombinant OR10C1, like other olfactory receptors, possesses seven transmembrane domains characteristic of G-protein coupled receptors (GPCRs). The protein contains conserved motifs essential for G-protein interaction and signal transduction, including DRY motifs in transmembrane region 3 and NPXXY motifs in transmembrane region 7. The extracellular loops and N-terminus contribute to the ligand-binding pocket, while the intracellular loops and C-terminus mediate downstream signaling. When comparing to similar olfactory receptors like OR1C1, which contains 314 amino acids, we can observe the typical GPCR structure with multiple transmembrane domains separated by intracellular and extracellular loops . The tertiary structure forms a barrel-like configuration where the transmembrane helices create a central binding pocket for odorant molecules, with variable regions contributing to specific odorant recognition.

What expression systems are most effective for recombinant OR10C1 production?

For successful expression of functional OR10C1, heterologous expression systems require careful optimization due to the notoriously difficult expression of olfactory receptors. While wheat germ cell-free systems have proven effective for OR family members like OR10X1 , mammalian expression systems such as HEK293 cells offer advantages for functional studies. Recent advances employing the TAR-Tat system have shown remarkable improvements in functional expression of human olfactory receptors by enhancing transcriptional efficiency through positive feedback mechanisms . This approach addresses a critical bottleneck in OR expression, as traditional methods often result in poor cell surface localization and limited functionality. For optimal results, researchers should consider using RTP1S and Ric8b co-expression to enhance trafficking, alongside the TAR-Tat system to boost transcription levels. Systematic comparison of different expression conditions is essential, including evaluation of various promoters, signal sequences, and trafficking enhancers.

How can the TAR-Tat system improve OR10C1 functional expression?

The TAR-Tat system represents a significant advancement for enhancing olfactory receptor expression, including OR10C1. This system increases transcription efficiency through a positive feedback mechanism, which has been demonstrated to significantly improve both cell surface expression and functional response of human olfactory receptors . The system works by incorporating the HIV-1 TAR (Trans-Activation Response) element into the expression vector, which is recognized by the HIV-1 Tat protein. When the Tat protein binds to TAR, it recruits positive transcription elongation factor b (P-TEFb), enhancing RNA polymerase II processivity and dramatically increasing transcription rates. For OR10C1 expression, implementing this system requires cloning the receptor coding sequence downstream of a TAR-containing promoter, alongside Tat expression. Researchers should optimize the ratio of OR10C1 and Tat expression vectors through transfection optimization experiments to achieve maximal expression while avoiding potential cytotoxicity from excessive Tat expression.

What are the recommended storage conditions for recombinant OR10C1 protein?

Recombinant olfactory receptors require careful storage to maintain their functionality. Based on protocols for similar olfactory receptors, OR10C1 should be stored in a Tris-based buffer containing 50% glycerol to prevent protein denaturation and maintain stability . For short-term storage (up to one week), aliquots can be kept at 4°C to avoid repeated freeze-thaw cycles. For long-term storage, -20°C is suitable, while -80°C is recommended for extended preservation periods. It is crucial to avoid repeated freeze-thaw cycles as these can significantly compromise protein integrity and function. Preparing single-use aliquots prior to freezing is strongly recommended. Storage buffers may be optimized with stabilizing agents such as specific detergents if the receptor is purified in its membrane-bound form. Researchers should verify protein stability through functional or structural assays after storage periods to ensure the receptor maintains its native conformation and ligand-binding capabilities.

How can I design experiments to identify specific ligands for OR10C1?

Designing experiments to identify OR10C1-specific ligands requires a multifaceted approach. Begin with computational screening using molecular docking to identify potential ligands based on the receptor's binding pocket characteristics. Follow this with in vitro validation using calcium imaging or cAMP assays in heterologous cells expressing OR10C1. Critical experimental controls must include cells lacking OR10C1 expression to identify non-specific responses, and cells expressing similar ORs (e.g., OR10 family members) to evaluate ligand selectivity . Consider implementing a high-throughput screening approach with a diverse odorant library organized by chemical class, starting with compounds known to activate related ORs. To maximize expression and detection sensitivity, employ the TAR-Tat system, which has demonstrated enhanced functional expression of human olfactory receptors . This system improves transcription efficiency through positive feedback, resulting in higher receptor density on the cell surface and enhanced functional responses. Design concentration-response experiments with identified hits to determine EC50 values and efficacy parameters, which are essential for characterizing ligand-receptor interactions quantitatively.

What methods can be used to study OR10C1 signaling pathway activation?

Studying OR10C1 signaling pathway activation requires methods that detect different aspects of the G-protein signaling cascade. The most direct approach involves calcium imaging using fluorescent calcium indicators (Fluo-4 AM or GCaMP) to visualize intracellular calcium flux upon receptor activation. This can be complemented with FRET-based cAMP sensors to monitor Gαs-mediated signaling. For comprehensive pathway analysis, researchers should employ phospho-specific antibodies to track the activation of downstream kinases (PKA, MAPK) using Western blotting or high-content imaging . Reporter gene assays using CRE-luciferase or NFAT-luciferase constructs provide alternative readouts for prolonged signaling responses. To establish pathway specificity, employ pharmacological inhibitors targeting different G-protein subunits or downstream effectors. When designing these experiments, it is crucial to include positive controls using receptors with well-characterized signaling (e.g., β2-adrenergic receptor for Gαs pathway) and negative controls with mutated OR10C1 lacking signaling capability. Analysis should incorporate time-course measurements to capture both rapid and delayed signaling events, as olfactory receptor signaling often exhibits complex temporal dynamics.

How can epigenetic factors influence OR10C1 expression and function?

Epigenetic mechanisms play crucial roles in regulating olfactory receptor expression and potentially impact OR10C1 functionality. DNA methylation status of the OR10C1 promoter region can significantly influence transcription levels, as observed in studies of related olfactory receptors. Environmental exposures to compounds such as benzo[a]pyrene have been shown to increase methylation of olfactory receptor promoters, potentially silencing gene expression . Conversely, cadmium dichloride exposure has been associated with decreased methylation of OR promoters, which could enhance expression . Histone modifications, particularly H3K4me3 and H3K27me3, contribute to the singular expression pattern of olfactory receptors in sensory neurons. For research applications, epigenetic modifiers such as DNA methyltransferase inhibitors (5-azacytidine) or histone deacetylase inhibitors (trichostatin A) can be used to experimentally manipulate OR10C1 expression. When designing studies investigating epigenetic regulation, researchers should employ bisulfite sequencing to map methylation patterns, ChIP-seq for histone modifications, and ATAC-seq to assess chromatin accessibility at the OR10C1 locus. These approaches provide insights into how environmental factors or experimental conditions might alter OR10C1 expression through epigenetic mechanisms.

What statistical approaches are recommended for analyzing OR10C1 functional data?

Analyzing OR10C1 functional data requires robust statistical approaches to account for the inherent variability in receptor expression and response. For dose-response experiments, nonlinear regression using four-parameter logistic models should be employed to determine EC50 values and efficacy parameters. When comparing multiple conditions or treatments, researchers should implement blocked experimental designs to reduce variability and increase statistical power . This approach groups similar experimental units together, making treatment effects easier to detect with fewer replicates. For time-course measurements of receptor activation, mixed-effects models are appropriate to account for both fixed (treatment) and random (cell-to-cell variation) effects. When analyzing RNA-seq or proteomics data related to OR10C1 expression, employ proper normalization methods and correction for multiple testing using approaches such as Benjamini-Hochberg procedure. Statistical power calculations should be performed prior to experiments to determine appropriate sample sizes, with considerations for the expected effect size and variability based on preliminary data. For all analyses, researchers should report not only p-values but also effect sizes and confidence intervals to provide a comprehensive view of the biological significance.

How can I address the problem of missing data in OR10C1 expression studies?

Missing data represents a significant challenge in OR10C1 expression studies, particularly when working with primary tissues or complex experimental designs. To mitigate this issue, implement a good experimental design that includes strategies to minimize data loss, such as including technical replicates and planning for potential sample attrition . When missing data occurs despite preventative measures, the approach to handling it depends on the pattern and mechanism of missingness. For data missing completely at random (MCAR), multiple imputation techniques using predictive mean matching or Bayesian approaches can be appropriate. For data missing at random (MAR), where missingness depends on observed variables, maximum likelihood methods or multiple imputation with auxiliary variables should be considered. For missing not at random (MNAR) scenarios, where missingness relates to unobserved factors, sensitivity analyses are essential to evaluate the impact of different assumptions. Researchers should transparently report the extent of missing data, the methods used to address it, and conduct sensitivity analyses to demonstrate the robustness of findings under different missing data handling approaches. Advanced techniques such as pattern-mixture models may be necessary for complex longitudinal studies of OR10C1 expression.

How can I distinguish between specific OR10C1 responses and non-specific effects in functional assays?

Distinguishing specific OR10C1 responses from non-specific effects requires careful experimental design and appropriate controls. First, include mock-transfected cells and cells expressing irrelevant receptors as negative controls to identify baseline responses and non-specific effects of the expression system. Second, employ concentration-response relationships to demonstrate the expected sigmoidal dose-dependency characteristic of receptor-mediated responses . Third, use selective antagonists or competitive inhibitors when available to block OR10C1-specific responses. Fourth, engineer receptor mutants with altered binding sites to demonstrate changes in ligand specificity correlating with structural modifications. Fifth, implement RNA interference or CRISPR/Cas9 knockout of OR10C1 to confirm the absence of response in receptor-depleted cells. For cell-based assays, normalize responses to receptor expression levels (determined by flow cytometry or Western blotting with epitope tags) to account for variation in transfection efficiency. When analyzing data, employ statistical methods that can separate specific signals from background noise, such as Z'-factor analysis for assay quality assessment. Finally, cross-validate findings using orthogonal assay methods measuring different aspects of receptor activation (calcium imaging, cAMP accumulation, receptor internalization) to confirm that observed effects are consistent across different readouts.

What are common challenges in achieving functional expression of OR10C1 and how can they be overcome?

Functional expression of OR10C1 faces several challenges common to olfactory receptors. Poor cell surface expression represents the primary obstacle, often resulting from misfolding and retention in the endoplasmic reticulum. To overcome this, researchers should co-express trafficking enhancers such as RTP1S, REEP1, and Ric8b, which facilitate proper folding and transport of ORs to the plasma membrane . Another significant challenge is low transcription efficiency, which can be addressed by implementing the TAR-Tat system that enhances transcription through positive feedback mechanisms . For protein production, codon optimization of the OR10C1 sequence for the expression host can significantly improve translation efficiency. Receptor function can be compromised by inappropriate membrane composition in heterologous systems; supplementing culture media with specific phospholipids or cholesterol may create a more native-like environment. For detection purposes, incorporating epitope tags (FLAG, HA) at the N-terminus after the signal sequence or at the C-terminus can facilitate visualization without disrupting function. When troubleshooting, systematic evaluation of expression conditions should include testing different cell lines (HEK293, HeLa, SF9), induction parameters, and temperature conditions (reduced temperature during expression can improve folding). Implementation of these strategies should be evaluated using quantitative measures of surface expression (flow cytometry, surface biotinylation) and functional responses (calcium imaging, cAMP assays).

How can I optimize experimental design to maximize the detection of OR10C1 responses to odorants?

Optimizing experimental design for OR10C1 odorant response detection requires addressing several key factors. First, implement blocking in your experimental design to group similar experimental units together, reducing variability within each block and making treatment effects easier to detect . This allows for more precise estimates with fewer experimental units. Second, enhance transcriptional efficiency using the TAR-Tat system, which has been demonstrated to significantly increase both cell surface expression and functional responses of human olfactory receptors . Third, optimize assay sensitivity by selecting appropriate detection methods; calcium imaging with high-sensitivity indicators (GCaMP6f) or impedance-based label-free systems can detect subtle responses that might be missed with traditional methods. Fourth, minimize background signaling by using serum-free media during stimulation and including appropriate vehicle controls. Fifth, employ repeated measures designs where possible to account for cell-to-cell variability, increasing statistical power. Sixth, consider using microfluidic systems for precise and reproducible odorant delivery, eliminating variability in stimulus application. Finally, implement data analysis pipelines that can detect responses with variable kinetics, as OR10C1 may exhibit different activation patterns depending on the ligand. For high-throughput screening, Z'-factor optimization should be performed to ensure assay robustness, with values above 0.5 indicating an excellent assay window.

How can OR10C1 research contribute to understanding environmental chemical interactions?

OR10C1 research provides valuable insights into environmental chemical interactions through several mechanisms. Studies with the rat ortholog (Or10c1) have demonstrated interactions with environmental pollutants, including polychlorinated biphenyls (PCBs) such as 2,2',4,4',5,5'-hexachlorobiphenyl and 2,2',5,5'-tetrachlorobiphenyl . These interactions suggest OR10C1 may function as a xenobiotic sensor beyond its olfactory role. Environmental compounds like benzo[a]pyrene affect OR10C1 through epigenetic mechanisms, altering promoter methylation and potentially changing expression patterns . To investigate these interactions, researchers should employ reporter gene assays with OR10C1 expression constructs to screen environmental compound libraries. Molecular dynamics simulations can predict binding modes of contaminants to the receptor. Transcriptomic analyses of tissues exposed to environmental chemicals should evaluate OR10C1 expression changes, while epigenetic profiling (methylation arrays, ChIP-seq) can reveal regulatory mechanisms. When designing these studies, researchers must include appropriate controls for solvent effects, implement concentration ranges relevant to environmental exposure levels, and consider species differences in receptor response. These approaches collectively contribute to understanding how environmental chemicals interact with olfactory receptors and potentially influence broader physiological processes.

What is the potential for using OR10C1 in biosensor development?

OR10C1 presents significant potential for biosensor development due to its ability to detect specific chemical ligands with high sensitivity. Creating OR10C1-based biosensors requires several engineering considerations. First, the receptor must be stabilized in non-native environments, potentially through computational design of stabilizing mutations or fusion with scaffold proteins. Second, coupling the receptor to appropriate signal transduction components is essential; options include linking to split fluorescent proteins that reconstitute upon ligand binding or connecting to ion channels that generate electrical signals upon activation. Third, immobilization strategies must preserve receptor function while providing durability; techniques such as oriented attachment to functionalized surfaces or incorporation into nanodiscs represent promising approaches . For practical biosensor applications, researchers should evaluate receptor specificity using comprehensive odorant panels to identify potential cross-reactivity, determine detection limits and dynamic range for target analytes, and assess stability under various environmental conditions (temperature, pH, ionic strength). Prototype biosensors should undergo validation with complex real-world samples containing potential interferents. Current limitations include the relatively poor stability of GPCRs outside their native membrane environment and challenges in achieving consistent receptor orientation during immobilization, areas where continued research is particularly valuable.

What approaches can be used to study OR10C1 involvement in non-olfactory tissues?

Investigating OR10C1 in non-olfactory tissues requires specialized approaches due to generally lower expression levels compared to olfactory epithelium. Begin with transcriptomic analysis using highly sensitive methods such as digital droplet PCR or targeted RNA-seq to quantify OR10C1 expression across diverse tissues. For protein detection, develop highly specific antibodies validated against heterologously expressed OR10C1, and employ techniques like proximity ligation assay to enhance detection sensitivity in tissue sections. Functional studies in non-olfactory contexts should utilize tissue-specific primary cell cultures or organoids rather than generic cell lines to maintain physiological relevance. CRISPR/Cas9-mediated knockout or knockdown strategies targeting OR10C1 in relevant tissues can reveal physiological roles through phenotypic analysis. When environmental chemicals show interaction with OR10C1, as demonstrated with compounds like 4,4'-diaminodiphenylmethane which increases Or10c1 expression , researchers should investigate potential biological consequences in affected non-olfactory tissues. Experimental designs must account for potentially different signaling mechanisms in non-olfactory contexts, which may not follow the canonical olfactory signaling pathway. Single-cell RNA-seq approaches are particularly valuable for identifying specific cell populations expressing OR10C1 within heterogeneous tissues, providing cellular context for functional studies. These comprehensive approaches can collectively illuminate the non-canonical functions of olfactory receptors beyond their primary sensory roles.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.