Recombinant Human Olfactory receptor 10G2 (OR10G2)

Shipped with Ice Packs
In Stock

Description

Functional Insights

OR10G2 participates in olfactory signal transduction through odorant binding, initiating cAMP-mediated neuronal responses . While its specific ligands remain uncharacterized, biophysical studies on homologous receptors (e.g., hOR1A1) reveal:

  • Ligand Binding: Micromolar-range affinity for odorants like dihydrojasmone .

  • Oligomerization: Exists in monomeric and dimeric states post-purification .

  • Tissue Expression: Detected in lung, HUVEC, HeLa, and MCF-7 cells via Western blot .

Research Applications

Recombinant OR10G2 is utilized in:

  • Antibody Validation: Polyclonal antibodies (e.g., Boster Bio A30855, Assay Genie PACO01203) target epitopes in the C-terminal region (AA 241–290) .

  • Ligand Screening: Employed in fluorescence-based binding assays and real-time cAMP monitoring .

  • Structural Studies: Purified via anti-FLAG affinity chromatography for circular dichroism and light scattering analyses .

Key Research Findings

  • Purification Yield: 1.6 mg (monomer) and 1.1 mg (dimer) obtained from 60 T175 flasks of HEK293 cells .

  • Cross-Reactivity: Antibodies show specificity for human, mouse, and rat OR10G2 .

  • Assay Compatibility: Validated for Western blot (1:500–1:2000 dilution), immunofluorescence, and ELISA .

Challenges and Future Directions

  • Ligand Deorphanization: OR10G2 remains an "orphan receptor" with no confirmed odorants .

  • Structural Resolution: Crystallographic data are lacking due to low native expression levels .

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchase method and location. For specific delivery estimates, please consult your local distributor.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%, which can serve as a reference for your use.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer components, storage temperature, and the intrinsic stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have specific tag type preferences, please inform us, and we will prioritize developing the specified tag.
Synonyms
OR10G2; Olfactory receptor 10G2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-310
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
OR10G2
Target Protein Sequence
MGKTKNTSLDAVVTDFILLGLSHPPNLRSLLFLVFFIIYILTQLGNLLILLTMWADPKLC ARPMYILLGVLSFLDMWLSSVTVPRLILDFTPSIKAIPFGGCVAQLYFFHFLGSTQCFLY TLMAYDRYLAICQPLHYPVLMNGRLCTVLVAGAWVAGSMHGSIQATLTFRLPYCGPNQVD YFICDIRAVLRLACADTTVNELVTFVDVRVVAASCFMLILLSYANIVHAILKIRTADGRR RAFSTCGSHLIVVTVYYVPCIFIYLRAGSKDPLDGAAAVFYTVVTPLLNPLIYTLRNQEV KSALKRITAG
Uniprot No.

Target Background

Function
Odorant receptor.
Database Links

HGNC: 8170

STRING: 9606.ENSP00000445383

UniGene: Hs.554580

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is OR10G2 and what is its functional role in human biology?

OR10G2 (olfactory receptor family 10 subfamily G member 2) is a protein encoded by the OR10G2 gene in humans. It functions as an olfactory receptor that interacts with odorant molecules in the nasal cavity to initiate neuronal responses that trigger the perception of specific smells. OR10G2 belongs to the G-protein-coupled receptor (GPCR) family, characterized by a distinctive 7-transmembrane domain structure that facilitates signal transduction. Like other olfactory receptors, OR10G2 plays a critical role in the molecular recognition of odorants and subsequent G protein-mediated transduction of odorant signals, ultimately contributing to our sense of smell through complex neuronal pathways .

The OR10G2 gene is located on chromosome 14q11.2 in humans, and like most olfactory receptor genes, it arises from a single coding exon. Notably, the olfactory receptor gene family is the largest gene family in the human genome, and the nomenclature assigned to these genes and proteins is organism-specific, independent of the naming conventions used for other species .

How does the structure of OR10G2 compare to other olfactory receptors?

OR10G2 shares the characteristic 7-transmembrane domain structure common to the GPCR superfamily, which includes many neurotransmitter and hormone receptors. This structural architecture consists of seven hydrophobic alpha-helical regions that span the cell membrane, connected by alternating intracellular and extracellular loops. The transmembrane domains create a binding pocket that determines the receptor's specificity for particular odorant molecules .

What are the recommended expression systems for producing recombinant OR10G2 protein?

For successful expression of recombinant OR10G2 protein, several expression systems have proven effective in olfactory receptor research. While wheat germ cell-free expression systems have been successfully employed for other olfactory receptors like OR10X1, providing good yields of functional protein suitable for techniques such as ELISA and Western blotting , mammalian expression systems are often preferred for GPCRs due to their ability to provide proper post-translational modifications and membrane integration.

For functional studies, heterologous expression in mammalian cell lines such as HEK293 or Hana3A cells (which express accessory proteins necessary for the membrane targeting of ORs) is recommended. The Hana3A cell line, specifically engineered to express several accessory proteins that facilitate proper folding and trafficking of olfactory receptors to the cell membrane, has become a standard for deorphanization studies of olfactory receptors . When establishing an expression system for OR10G2, researchers should consider incorporating receptor transport proteins (RTPs) and receptor expression enhancing proteins (REEPs) in their expression constructs to improve membrane targeting and functional expression.

What methodologies are most effective for deorphanization studies of OR10G2?

Deorphanization—the process of identifying ligands that activate an orphan receptor—remains a significant challenge for many olfactory receptors including OR10G2. Based on established protocols for olfactory receptor research, the Dual-Luciferase reporter assay optimized for OR screening represents one of the most effective methodologies . This approach involves:

  • Transfection of cells (preferably Hana3A) with:

    • OR10G2 expression plasmid

    • CRE-luciferase reporter construct (cAMP-responsive element)

    • Renilla luciferase control reporter

  • Exposure to potential ligands, either individually or in mixtures such as Henkel 100 (which contains diverse chemical compounds including aliphatics, alcohols, aromatics, amines, alkanes, aldehydes, esters, ethers, ketones, and heterocyclics)

  • Measurement of firefly luciferase activity normalized to Renilla luciferase to quantify receptor activation

For more detailed analysis of ligand-receptor interactions, calcium imaging techniques using FURA-2-AM can be employed to measure intracellular calcium flux upon receptor activation. This approach allows for real-time monitoring of receptor responses to different ligand concentrations, providing insights into the pharmacological properties of OR10G2 .

How can CRISPR-based technologies be utilized to study OR10G2 function?

CRISPR-based technologies offer powerful approaches for investigating OR10G2 function through both gene knockout and activation strategies. For gene activation studies, CRISPR Activation (CRISPRa) systems utilizing a deactivated Cas9 (dCas9) nuclease fused to a VP64 activation domain can be employed to upregulate endogenous OR10G2 expression .

The synergistic activation mediator (SAM) transcription activation system, which combines dCas9-VP64 with sgRNA (MS2) and the MS2-P65-HSF1 fusion protein, provides a robust method for maximizing the activation of endogenous OR10G2 gene expression. This approach is particularly valuable for studying OR10G2 in its native genomic context, avoiding potential artifacts associated with overexpression of recombinant constructs .

Specifically, researchers can use OR10G2 Lentiviral Activation Particles designed for the SAM transcription activation system to upregulate expression via lentiviral transduction. This method offers several advantages, including:

  • Stable integration into the host genome for long-term expression

  • High transduction efficiency across various cell types

  • Ability to activate expression of endogenous OR10G2 with its native regulatory elements

What genetic variants of OR10G2 have been identified and what are their functional implications?

The analysis of OR10G2 genetic variants requires sophisticated next-generation sequencing approaches that can detect both sequence variations and copy number alterations. Clinical genetic testing for OR10G2 employs methodologies including next-generation sequencing for deletion/duplication analysis and sequence analysis of the entire coding region, with reported analytical sensitivity, specificity, and accuracy of >98%, 96%, and 97%, respectively .

While our search results don't provide specific information about identified variants in OR10G2, researchers investigating this receptor should consider several types of genetic variations that commonly occur in olfactory receptor genes:

  • Single nucleotide polymorphisms (SNPs) in coding regions that may alter amino acid sequences, potentially affecting ligand-binding properties

  • Copy number variations (CNVs) that may modify expression levels

  • Pseudogenization events that can render the receptor non-functional

To properly interpret identified variants, researchers should conduct comparative genomic analyses across populations, perform in silico prediction of functional effects, and validate findings through functional assays such as the Dual-Luciferase reporter system described earlier .

How do I design appropriate primers for OR10G2 genotyping and expression analysis?

Designing appropriate primers for OR10G2 genotyping and expression analysis requires careful consideration of several factors to ensure specificity and efficiency. Given that OR10G2 is located on chromosome 14q11.2 and belongs to a large gene family with potentially high sequence similarity among members, the following methodological approach is recommended:

  • Sequence Analysis and Primer Design:

    • Obtain the complete genomic and cDNA sequences for OR10G2 from databases such as NCBI

    • Perform multiple sequence alignment with closely related olfactory receptors to identify unique regions

    • Design primers targeting exon-specific sequences with minimal homology to other OR genes

    • Ensure primers span exon-exon junctions for expression analysis to avoid genomic DNA amplification

    • Verify primer specificity using in silico PCR tools like UCSC In-Silico PCR or Primer-BLAST

  • Recommended Parameters for Primer Design:

    • Length: 18-25 nucleotides

    • GC content: 40-60%

    • Melting temperature (Tm): 58-62°C with <2°C difference between primer pairs

    • Avoid secondary structures and primer-dimer formation

    • Include at least 3 G/C nucleotides at the 3' end for improved specificity

  • Validation Strategy:

    • Test primers on control samples with known OR10G2 genotypes

    • Sequence amplified products to confirm target specificity

    • Consider including positive and negative control primer sets targeting housekeeping genes and related OR genes, respectively

How can OR10G2 ligand binding properties be characterized through computational modeling?

Characterizing the ligand binding properties of OR10G2 through computational modeling involves a sophisticated multi-step approach that integrates structural bioinformatics, molecular docking, and molecular dynamics simulations. Although no crystal structure exists for OR10G2, homology modeling can be employed using related GPCRs with solved structures as templates.

A methodological workflow for computational characterization of OR10G2-ligand interactions includes:

  • Homology Model Construction:

    • Identify suitable GPCR template structures (typically class A GPCRs with available crystal structures)

    • Generate sequence alignments focusing on conserved motifs in transmembrane domains

    • Build multiple homology models using software such as MODELLER or SWISS-MODEL

    • Refine models through energy minimization and loop modeling

    • Validate structural quality using Ramachandran plots and scoring functions

  • Binding Pocket Analysis:

    • Identify potential binding sites using CASTp, SiteMap, or similar tools

    • Analyze physiochemical properties and conservation of binding pocket residues

    • Compare binding pocket architecture with related ORs of known specificity

  • Molecular Docking Studies:

    • Prepare a library of potential ligands based on known odorants

    • Perform flexible docking using tools such as AutoDock Vina or Glide

    • Analyze binding energies and interaction patterns

    • Identify key residues involved in ligand recognition

  • Molecular Dynamics Simulations:

    • Embed the receptor-ligand complex in a lipid bilayer membrane

    • Perform extended (100ns-1μs) all-atom simulations

    • Analyze conformational changes, binding stability, and potential activation mechanisms

    • Calculate binding free energies using methods such as MM-PBSA or FEP

This computational approach provides theoretical insights that should be validated experimentally using methods described in previous sections, such as site-directed mutagenesis of predicted key residues followed by functional assays .

What are the most effective protocols for analyzing OR10G2 trafficking and localization in cellular models?

Analyzing OR10G2 trafficking and localization in cellular models requires specialized techniques to overcome the notorious difficulty of proper membrane expression commonly observed with olfactory receptors. An effective experimental protocol combines molecular biology, advanced microscopy, and biochemical approaches:

  • Expression System Optimization:

    • Use Hana3A cells or modified HEK293 cells expressing RTP1S, RTP2, REEP1, and Ric8b accessory proteins

    • Incorporate N-terminal tags that enhance surface expression (e.g., rhodopsin or Lucy tags)

    • Consider codon optimization of the OR10G2 sequence for improved expression

  • Fluorescent Protein Tagging Strategies:

    • C-terminal fusion with fluorescent proteins (e.g., GFP, mCherry) for live-cell imaging

    • Include linker sequences to minimize interference with receptor function

    • Create dual-tagged constructs with pH-sensitive GFP variants for discrimination between surface and internal pools

  • Immunocytochemistry Protocol:

    • Fix cells with 4% paraformaldehyde (10 minutes, room temperature)

    • Permeabilize with 0.1% Triton X-100 for internal epitope detection

    • Block with 5% normal serum from the same species as the secondary antibody

    • Incubate with primary antibodies against OR10G2 and organelle markers

    • Apply fluorophore-conjugated secondary antibodies

    • Counterstain nuclei with DAPI

    • Mount and image using confocal microscopy

  • Quantitative Analysis Methods:

    • Surface expression quantification using cell-surface biotinylation

    • Flow cytometry with extracellular epitope antibodies for population analysis

    • ELISA-based detection of surface expression levels

    • Image analysis with colocalization coefficients for organelle association (ER, Golgi, endosomes)

  • Trafficking Dynamics Investigation:

    • Photoactivatable or photoconvertible tags for pulse-chase imaging

    • Temperature-induced trafficking blocks (e.g., 15°C for Golgi exit block)

    • Endocytosis assays using antibody feeding techniques

This comprehensive approach enables detailed characterization of OR10G2 cellular processing, potentially identifying specific trafficking requirements that could inform future functional studies .

How can genetic variation in OR10G2 be analyzed in clinical contexts?

Analyzing genetic variation in OR10G2 in clinical contexts requires a systematic approach that combines advanced sequencing technologies with robust bioinformatic analysis and functional validation. Clinical genetic testing for OR10G2 is available through specialized laboratories, employing comprehensive methodologies including next-generation sequencing for both sequence analysis and deletion/duplication assessment .

A methodological framework for clinical genetic analysis of OR10G2 includes:

  • DNA Sampling and Extraction:

    • Collect appropriate biological samples (peripheral blood, buccal swabs)

    • Extract high-quality genomic DNA using validated clinical protocols

    • Assess DNA quality and quantity through spectrophotometry and fluorometry

  • Sequencing Approaches:

    • Targeted next-generation sequencing of OR10G2 coding regions and flanking sequences

    • Inclusion in broader olfactory receptor gene panels or exome sequencing

    • Implementation of amplicon-based or capture-based enrichment strategies

    • Minimum coverage requirements typically >20-30x for clinical applications

  • Variant Detection and Analysis:

    • Alignment to reference genome (GRCh38/hg38)

    • Variant calling for SNVs, small indels, and CNVs

    • Filtering based on quality metrics (base quality, mapping quality, strand bias)

    • Annotation with functional prediction tools and population frequency databases

  • Variant Classification Framework:

    • Population frequency assessment (gnomAD, 1000 Genomes)

    • In silico prediction of functional impact (SIFT, PolyPhen, CADD)

    • Evolutionary conservation analysis

    • Classification according to ACMG/AMP guidelines

  • Reporting and Interpretation:

    • Clear documentation of methodologies with analytical metrics (sensitivity >98%, specificity >96%, accuracy >97%)

    • Detailed variant classification with supporting evidence

    • Clinical correlation with phenotypic data when available

    • Recommendations for familial testing when appropriate

For research contexts that interface with clinical applications, ensuring compliance with applicable regulatory standards and validation of analytical performance metrics is essential for generating translatable findings.

What methodological approaches are most suitable for investigating potential extranasal functions of OR10G2?

Investigating potential extranasal functions of OR10G2 requires specialized methodological approaches that address the challenges of detecting low-abundance expression and characterizing non-canonical signaling in diverse tissue types. While our search results don't specifically document extranasal expression of OR10G2, numerous olfactory receptors have been identified in non-olfactory tissues, suggesting possible unexplored functions for OR10G2 beyond olfaction .

A comprehensive strategy for investigating extranasal functions includes:

  • Expression Profiling Across Tissues:

    • RNA-Seq analysis of tissue panels with high sequencing depth

    • qRT-PCR with highly specific primers and probes for sensitive detection

    • Single-cell RNA-Seq to identify specific cell populations expressing OR10G2

    • In situ hybridization to localize expression at cellular resolution

    • Receptor-specific antibody development for immunohistochemical detection

  • Functional Characterization in Non-Olfactory Contexts:

    • Tissue-specific gene knockout or knockdown models (CRISPR/Cas9 or RNAi)

    • Implementation of CRISPR activation systems for controlled upregulation

    • Investigation of alternative signaling pathways beyond canonical Golf/cAMP

    • Calcium imaging, BRET, and FRET assays for detecting diverse signaling events

    • Physiological assays tailored to specific tissue functions

  • Identification of Endogenous Ligands:

    • Tissue extract fractionation and screening

    • Metabolomics approach to identify candidate endogenous activators

    • Validation using receptor activation assays described previously

    • Investigation of local synthesis pathways for identified ligands

  • Physiological and Pathophysiological Relevance:

    • Correlation of expression patterns with physiological states and disease conditions

    • Phenotypic analysis of tissue-specific knockout models

    • Integration with genome-wide association studies implicating the OR10G2 locus

    • Exploration of potential receptor-receptor interactions and heteromerization

This methodological framework provides a foundation for discovering novel functions of OR10G2 beyond its canonical role in olfaction, potentially revealing unexpected therapeutic targets or biomarkers .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.