Recombinant Human Olfactory receptor 10G4 (OR10G4)

Shipped with Ice Packs
In Stock

Description

Molecular Characterization

OR10G4 is a class A G-protein-coupled receptor (GPCR) encoded by the OR10G4 gene on chromosome 11q24.2. The recombinant form is synthesized using an E. coli expression system, with a full-length protein sequence (amino acids 1–311) and an N-terminal 10xHis tag for purification .

PropertyDetails
UniProt IDQ8NGN3
Expression SystemIn vitro E. coli
Protein Length311 amino acids
Storage-20°C (short-term); -80°C (long-term)
Key Domains7-transmembrane structure, characteristic of GPCRs
TagsN-terminal 10xHis for purification

The receptor’s sequence begins with MSNASLVTAFILTGLPHAPGLDALLFGIFLVVYVLTVLGNLLILLVIRVDSHLHTP..., highlighting conserved GPCR motifs .

Functional Insights

OR10G4 binds odorants such as guaiacol (smoky aroma), vanillin, and ethyl vanillin. Functional assays reveal that:

  • Guaiacol affinity is strongly influenced by OR10G4 variants, with nonsynonymous substitutions reducing receptor sensitivity .

  • In vitro responses correlate with human perceptual differences: individuals with impaired OR10G4 alleles rate guaiacol as weaker and more pleasant .

Key Agonists and Responses

OdorantPerceptual ImpactVariance Explained
GuaiacolIntensity (15.4%), Valence (10%)
VanillinNo significant genotype-phenotype correlation
Ethyl VanillinNo significant genotype-phenotype correlation

Genetic Variability and Perceptual Impact

Approximately 63% of olfactory receptors exhibit functional polymorphisms, and OR10G4 is a prime example:

  • Four common alleles (MAF > 4%) alter ligand-binding affinity through combinatorial amino acid substitutions .

  • Allele-specific effects: For guaiacol, carriers of non-functional alleles show reduced sensitivity (EC₅₀ shifted by 1–2 log units) .

AlleleFunctional ImpactFrequency
ReferenceHigh guaiacol response44%
Allele 2Moderate affinity reduction28%
Allele 3Severe impairment (multiple SNPs)18%
Allele 4Non-functional (no ligand response)10%

Research Applications

Recombinant OR10G4 facilitates structural and mechanistic studies:

  • Ligand binding assays: Tryptophan fluorescence assays confirm micromolar-range affinity for dihydrojasmone, a related odorant .

  • Database integration: OR10G4-odorant interactions are cataloged in M2OR, the largest olfactory receptor database (51,395 unique pairs) .

  • Structural studies: Purification via anti-FLAG immunoaffinity and gel filtration yields monomeric (1.6 mg) and dimeric (1.1 mg) receptor forms for crystallography .

Technical Considerations

  • Stability: Repeated freeze-thaw cycles degrade functionality; working aliquots should be stored at 4°C .

  • Assay compatibility: Luciferase-based Hana3A cell systems are preferred for functional screening .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery details.
Note: Our proteins are standardly shipped with blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us and we will prioritize developing the specified tag.
Synonyms
OR10G4; Olfactory receptor 10G4; Olfactory receptor OR11-278
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-311
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
OR10G4
Target Protein Sequence
MSNASLVTAFILTGLPHAPGLDALLFGIFLVVYVLTVLGNLLILLVIRVDSHLHTPMYYF LTNLSFIDMWFSTVTVPKMLMTLVSPSGRAISFHSCVAQLYFFHFLGSTECFLYTVMSYD RYLAISYPLRYTSMMSGSRCALLATGTWLSGSLHSAVQTILTFHLPYCGPNQIQHYFCDA PPILKLACADTSANVMVIFVDIGIVASGCFVLIVLSYVSIVCSILRIRTSDGRRRAFQTC ASHCIVVLCFFVPCVVIYLRPGSMDAMDGVVAIFYTVLTPLLNPVVYTLRNKEVKKAVLK LRDKVAHPQRK
Uniprot No.

Target Background

Function
Odorant receptor.
Gene References Into Functions
  1. This study confirms that variations in the OR10G4 genotype account for over 15% of the variation in perceived intensity and over 10% of the variation in perceived valence for the high-affinity in vitro agonist guaiacol. PMID: 24316890
  2. Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator) PMID: 20379614
Database Links

HGNC: 14809

KEGG: hsa:390264

STRING: 9606.ENSP00000325076

UniGene: Hs.553760

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is OR10G4 and what is its biological function?

OR10G4 is a protein encoded by the OR10G4 gene in humans. It belongs to the large family of G-protein-coupled receptors (GPCRs) that are responsible for odorant detection . Like other olfactory receptors, OR10G4 has a characteristic 7-transmembrane domain structure similar to many neurotransmitter and hormone receptors . Its primary function is to interact with specific odorant molecules in the nasal epithelium, triggering neuronal responses that ultimately lead to the perception of smell .

OR10G4 is particularly noteworthy for its role in the perception of "smoky" odorants such as guaiacol, with genetic variants of this receptor showing significant effects on both perceived intensity and pleasantness of these compounds .

What are the known ligands for OR10G4?

Based on the available research data, OR10G4 has several confirmed agonists with varying affinities:

OdorantRelative AffinityPerceptual Impact of OR10G4 Variation
GuaiacolHigh affinity>15% of variance in perceived intensity; >10% of variance in perceived valence
VanillinLower affinityLimited perceptual impact correlated with OR10G4 genotype
Ethyl vanillinLower affinityLimited perceptual impact correlated with OR10G4 genotype

Guaiacol serves as the high-affinity agonist for OR10G4, making it an excellent probe compound for studying this receptor's function. The receptor's response to guaiacol has been well-documented in heterologous assay systems, with clear concentration-response relationships established .

How is OR10G4 genetic variation distributed in human populations?

The OR10G4 gene exhibits considerable genetic diversity in human populations. Research has identified multiple alleles with minor allele frequencies (MAF) greater than 4% . These genetic polymorphisms often result in amino acid substitutions that can significantly alter receptor function.

Different populations may show varied distributions of these alleles, though functional differences do not necessarily correlate directly with geographical or ancestral groups. While greater genetic variability has been observed among individuals of African descent, studies suggest that much of this diversity does not translate into functional differences relative to other groups .

What expression systems are most effective for recombinant OR10G4 studies?

For functional characterization of OR10G4, heterologous expression systems have proven most effective. The most widely used approach involves:

  • Mammalian cell lines (typically HEK293T cells) for transient transfection

  • Co-expression with accessory proteins that facilitate surface expression

  • Reporter gene assays (such as luciferase) to detect receptor activation

This methodology takes advantage of the fact that ORs are GPCRs that couple to endogenous stimulatory G proteins, with activation elevating intracellular cAMP . When using a luciferase reporter assay, the firefly luciferase construct is placed under the control of a cAMP response element, allowing OR activation to be measured as an increase in luciferase signal .

To control for variables such as cell number, viability, and transfection efficiency, cells are typically co-transfected with a constitutively active Renilla luciferase, allowing normalization of data. The ratio of firefly-to-Renilla luciferase signal serves as an index of OR activation .

How can researchers confirm proper cell surface trafficking of recombinant OR10G4?

A critical prerequisite for functional studies is confirming that the recombinant OR10G4 properly traffics to the cell surface, as ORs must be expressed on the plasma membrane to interact with odorants in the assay media . Methods to verify surface expression include:

  • Immunocytochemistry with epitope-tagged receptors

  • Flow cytometry of non-permeabilized cells

  • Surface biotinylation assays

Research has shown that not all olfactory receptors traffic efficiently to the cell surface in heterologous systems. For example, in studies of multiple ORs, only five of seven receptors examined met surface expression criteria for further functional characterization .

How do genetic polymorphisms in OR10G4 affect receptor function?

Genetic polymorphisms in OR10G4 can dramatically alter its functional properties. Research has identified four common OR10G4 alleles with varying functional profiles when exposed to agonists :

AlleleAmino Acid ChangesFunctional ImpactEC50 Value for Guaiacol
Reference-Normal functionlog(EC50) ≈ -7.0
Allele 2LPSGVAANormal functionSimilar to reference
Allele 3VLTYVGPEGQReduced functionlog(EC50) ≈ -6.2
Allele 4ALICVSSEGQSeverely impaired functionNon-functional (similar to vector control)

Importantly, functional studies have demonstrated that the impaired function observed in alleles 3 and 4 cannot be attributed to any single SNP . Rather, multiple residues appear to interact to cause the decrease in affinity, highlighting the complex structure-function relationships in olfactory receptors .

How can OR10G4 genotype be correlated with perceptual phenotypes?

Correlating OR10G4 genotype with perceptual phenotypes requires a multidisciplinary approach:

  • Genotyping: Sequence the OR10G4 gene from study participants to identify their specific alleles

  • Psychophysical testing: Have participants rate the perceived intensity and valence (pleasantness) of known OR10G4 agonists

  • Statistical analysis: Use multiple regression to determine if OR10G4 allele type predicts odorant perception

In one comprehensive study, researchers obtained OR10G4 sequences from 308 participants who had rated their perceived intensity and valence for guaiacol, vanillin, and ethyl vanillin . Multiple regression analysis revealed that OR10G4 allele type predicted 15.4% of the variance in perceived intensity of guaiacol (r² = 0.165, adjusted r² = 0.154, F(4,303) = 15.0, p < 0.001) .

These findings demonstrate that despite the olfactory system using a combinatorial code (where responses from multiple receptor types contribute to odorant recognition), the response of a single receptor can significantly influence perception of specific odorants .

What are appropriate controls for OR10G4 functional studies?

Rigorous controls are essential when studying recombinant OR10G4:

  • Vector-only controls: Cells transfected with empty expression vector to establish baseline responses

  • Known functional OR10G4 variants: Including reference sequence OR10G4 as a positive control

  • Non-functional OR10G4 variants: To establish floor effects (e.g., the ALICVSSEGQ variant)

  • Statistical validation: Extra sum of squares F-test against vector control to confirm responses are receptor-mediated

For example, research has shown that there is no significant difference in response between cells transfected with the non-functional allele 4 (ALICVSSEGQ) and cells transfected with vector only (extra sum of squares F test against vector control, F(3,42) = 2.2, p = 0.11) , confirming this variant's lack of function.

How do specific amino acid substitutions affect OR10G4 function?

Understanding the relationship between specific amino acid substitutions and OR10G4 function requires systematic mutagenesis approaches:

  • Generate receptors with individual SNPs in a reference background

  • Test each variant's response to agonists using functional assays

  • Compare EC50 values and maximum responses to identify critical residues

Research has shown that in some cases (e.g., alleles 3 and 4), no single SNP accounts for the functional impairment observed . This suggests complex interactions between multiple residues that collectively determine receptor function.

When investigating structure-function relationships in OR10G4 or other olfactory receptors, researchers should consider:

  • Transmembrane domain residues that may form the ligand-binding pocket

  • Intracellular residues that may affect G-protein coupling

  • N-terminal residues that may influence receptor trafficking

What bioinformatic approaches are useful for analyzing OR10G4 sequence variants?

Bioinformatic analyses can provide valuable insights into OR10G4 function:

  • Homology modeling: Based on crystal structures of other GPCRs to predict the 3D structure of OR10G4

  • Evolutionary conservation analysis: To identify functionally critical residues

  • Molecular dynamics simulations: To predict how variants might affect ligand binding or receptor conformational changes

  • Population genetics tools: To analyze the distribution and frequency of OR10G4 variants across human populations

These approaches can help predict how newly discovered variants might affect receptor function before experimental validation, potentially accelerating research progress.

How might OR10G4 interact with other olfactory receptors in a combinatorial coding system?

While the olfactory system uses a combinatorial code where multiple receptors contribute to odor perception, research on OR10G4 demonstrates that single receptors can have outsized effects on perception of specific odorants . Future research directions could include:

  • Identifying other receptors that respond to guaiacol and related compounds

  • Investigating potential interactions between OR10G4 and other ORs in perception

  • Developing computational models that predict perceptual outcomes based on activation patterns across multiple receptors

What are promising approaches for high-throughput screening of OR10G4 agonists and antagonists?

Developing more efficient screening methods for OR10G4 ligands would accelerate research in this field. Promising approaches include:

  • Calcium imaging in cells expressing OR10G4 and appropriate G proteins

  • Automated patch-clamp techniques for direct measurement of receptor activation

  • Bioluminescence resonance energy transfer (BRET) assays to detect conformational changes upon ligand binding

  • Machine learning algorithms to predict potential ligands based on molecular structure

Such high-throughput approaches could expand our understanding of OR10G4's ligand profile beyond the currently known agonists (guaiacol, vanillin, and ethyl vanillin).

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.