Recombinant Human Olfactory receptor 10G9 (OR10G9)

Shipped with Ice Packs
In Stock

Description

Recombinant Production and Expression Systems

Recombinant OR10G9 is produced in heterologous systems to study its biophysical properties. Common platforms include:

Table 1: Expression Systems for Recombinant OR10G9

SystemHost Cell TypeTag/ModificationYield & PurityApplication
HEK293SMammalianFLAG-rho1D4 dual epitope1.6 mg (monomer), 1.1 mg (dimer) Functional assays, ligand binding studies
Wheat GermCell-freeGST-tagged (N-terminal)Not quantified Structural studies
E. coliProkaryoticHis-tagged (N-terminal)High purity, full-length Antibody production, ELISA

Functional validation in HEK293 cells confirmed cAMP-mediated signaling upon odorant binding .

Functional and Ligand-Binding Properties

OR10G9 operates via a combinatorial coding mechanism, where activation depends on odorant structural features and concentration . Key findings:

  • Ligand Specificity: OR10G9 likely recognizes hydrophobic compounds, consistent with class II receptor behavior .

  • Binding Affinity: Micromolar-range affinity observed for related receptors (e.g., hOR1A1 binds dihydrojasmone at ~10 μM) .

  • Dimerization: Purified OR10G9 exists in monomeric and dimeric forms, suggesting oligomerization may modulate signaling .

Challenges and Future Directions

Despite advances, OR10G9 research faces hurdles:

  • Ligand Deorphanization: No specific odorants confirmed for OR10G9, unlike related receptors (e.g., OR1A1) .

  • Structural Data: No crystallographic or cryo-EM structures available .

  • In Vivo Relevance: Physiological roles beyond olfaction (e.g., airway function) remain unexplored .

Efforts to map OR10G9’s interactome and develop targeted agonists/antagonists could unlock therapeutic potential in metabolic or neurological disorders .

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped on blue ice unless dry ice shipping is specifically requested and agreed upon in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Before opening, briefly centrifuge the vial to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its incorporation.
Synonyms
OR10G9; OR10G10P; Olfactory receptor 10G9; Olfactory receptor 10G10
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-311
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
OR10G9
Target Protein Sequence
MSKTSLVTAFILTGLPHAPGLDAPLFGIFLVVYVLTVLGNLLILLVIRVDSHLHTPMYYF LTNLSFIDMWFSTVTVPKMLMTLVSPSGRAISFHSCVAQLYFFHFLGSTECFLYTVMSYD RYLAISYPLRYTSMMSGSRCALLATSTWLSGSLHSAVQTILTFHLPYCGPNQIQHYLCDA PPILKLACADTSANEMVIFVDIGLVASGCFLLIVLSYVSIVCSILRIHTSEGRHRAFQTC ASHCIVVLCFFVPCVFIYLRPGSRDVVDGVVAIFYTVLTPLLNPVVYTLRNKEVKKAVLK LRDKVAHSQGE
Uniprot No.

Target Background

Function
Odorant receptor.
Database Links

HGNC: 15129

KEGG: hsa:219870

STRING: 9606.ENSP00000364164

UniGene: Hs.553636

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Olfactory Receptor 10G9 (OR10G9) and what is its primary function?

Olfactory Receptor 10G9 (OR10G9) is a human olfactory receptor protein that functions as an odorant receptor. It belongs to the G-protein coupled receptor 1 family and is primarily involved in olfactory signal transduction pathways . As an olfactory receptor, OR10G9 is designed to detect specific odorant molecules, initiating a cascade of signaling events that ultimately lead to odor perception. The protein is characterized by its transmembrane structure, which is typical of G-protein coupled receptors, allowing it to span the cell membrane and transduce signals from the extracellular environment to the cell interior. OR10G9 contains 311 amino acids and has a specific sequence that determines its odorant binding specificity and signaling properties .

What is the cellular localization of OR10G9 and how does this affect its functionality?

OR10G9 is primarily localized to the cell membrane, which is consistent with its function as a receptor protein . This membrane localization is essential for its role as an olfactory receptor, as it positions the protein's binding domain to detect extracellular odorant molecules. The transmembrane domains of OR10G9 anchor it within the lipid bilayer, with specific extracellular loops forming the odorant binding pocket. The intracellular domains interact with G-proteins to initiate downstream signaling cascades following odorant binding. This cellular localization is critical for experimental design considerations, as studies of OR10G9 function require systems that support proper membrane insertion and folding to maintain the protein's native conformation and functionality.

What are the validated applications for recombinant OR10G9 protein in research?

Recombinant OR10G9 protein has been validated for several research applications, primarily ELISA (Enzyme-Linked Immunosorbent Assay) and Western blot analyses . These applications allow researchers to study the protein's expression, binding characteristics, and interactions with other molecules. In ELISA applications, the recombinant protein can be used as a standard for quantification, as an antigen for antibody development, or in binding studies to identify potential ligands. For Western blot applications, the GST-tagged recombinant OR10G9 can be detected at approximately 60-65 kDa on SDS-PAGE (the exact size depends on the tag system used), providing a tool for validation of antibody specificity and protein expression studies . It's important to note that these recombinant proteins are specifically designed for research use only and not for diagnostic or therapeutic applications.

How can OR10G9 be studied in olfactory signaling pathway research?

To study OR10G9 in olfactory signaling pathway research, investigators can employ several methodological approaches:

  • Heterologous expression systems: Express OR10G9 in cell lines (such as HEK293) that can be easily transfected and allow for proper protein folding and membrane localization.

  • Calcium imaging assays: Since olfactory receptors activate G-proteins leading to calcium flux, calcium-sensitive dyes or genetically encoded calcium indicators can be used to measure receptor activation in response to potential ligands.

  • GPCR-specific functional assays: Employ assays that measure cAMP production, IP3 generation, or β-arrestin recruitment following receptor activation.

  • Molecular modeling and docking studies: Use the amino acid sequence information to create structural models and predict potential binding sites and ligand interactions.

  • Co-immunoprecipitation studies: Identify protein-protein interactions within the signaling cascade using antibodies specific to OR10G9.

These approaches can be combined with gene silencing or overexpression studies to further elucidate the role of OR10G9 in olfactory signal transduction pathways.

What experimental design methods are most appropriate for studying OR10G9 function?

When studying OR10G9 function, several experimental design methods can be employed, depending on the specific research question:

  • Full factorial design: This approach is suitable when investigating multiple factors that may affect OR10G9 function, such as temperature, pH, ligand concentration, and co-expression of signaling partners. It allows for examination of both individual factor effects and their interactions .

  • Fractional factorial design: When resource constraints prevent testing all possible combinations in a full factorial design, this approach provides a more efficient alternative, particularly useful for initial screening of conditions for OR10G9 expression or activity .

  • Box-Behnken design: This method is effective for optimizing experimental conditions for OR10G9 functional assays, allowing researchers to model response surfaces and identify optimal ranges for key variables without requiring testing at extreme values .

  • Central composite design: Particularly useful for response surface methodology, this approach can help identify optimal conditions for OR10G9 expression, purification, or functional assays while minimizing the number of experiments required .

The choice of design should be guided by the specific research objectives, available resources, and the number of variables being investigated. For initial characterization of OR10G9 ligand binding properties, a Plackett-Burman design might be employed to screen multiple potential ligands efficiently.

What are the critical considerations for expressing and purifying recombinant OR10G9?

Expressing and purifying recombinant OR10G9 presents several challenges due to its nature as a transmembrane protein. Critical considerations include:

  • Expression system selection: Wheat germ expression systems have proven effective for producing functional OR10G9 . This cell-free system provides advantages for membrane protein expression by avoiding toxicity issues often encountered in cellular systems.

  • Tag selection and placement: N-terminal tags such as GST can facilitate purification while minimizing interference with protein function . Consider the impact of tag size and position on protein folding and activity.

  • Detergent optimization: As a membrane protein, OR10G9 requires appropriate detergents for solubilization and purification while maintaining native conformation. A detergent screening approach may be necessary.

  • Storage conditions: Recombinant OR10G9 stability can be maintained by storage at -20°C for short-term use or -80°C for extended storage . Avoid repeated freeze-thaw cycles which can denature the protein.

  • Quality control: Validation using SDS-PAGE (12.5% gels have been shown to effectively resolve the protein) with Coomassie Blue staining can confirm protein integrity and purity .

A systematic optimization approach using Design of Experiments (DOE) methodology can efficiently identify optimal conditions for expression and purification while minimizing resource expenditure.

How should researchers validate the functionality of recombinant OR10G9 in experimental systems?

Validating the functionality of recombinant OR10G9 in experimental systems requires multiple complementary approaches:

  • Structural validation: Confirm proper folding and membrane insertion using circular dichroism spectroscopy, limited proteolysis, and thermal stability assays.

  • Ligand binding assays: Employ radioligand binding, surface plasmon resonance (SPR), or fluorescence-based binding assays with known or predicted odorant ligands.

  • Functional signaling assays: Validate downstream signaling using:

    • GTPγS binding assays to measure G-protein activation

    • Second messenger (cAMP, calcium) assays to confirm signal transduction

    • BRET/FRET assays to detect conformational changes upon ligand binding

  • Control experiments: Include both positive controls (well-characterized olfactory receptors) and negative controls (inactive receptor mutants or unrelated GPCRs).

  • Reproducibility assessment: Validate functionality across multiple protein batches and experimental conditions to ensure consistent results.

These validation steps should be documented with quantitative metrics and statistical analysis to establish confidence in the functionality of the recombinant receptor.

How can OR10G9 be utilized in deorphanization studies?

Deorphanization studies aim to identify the specific ligands that activate orphan receptors like OR10G9. A systematic approach includes:

  • High-throughput screening: Test large odorant libraries using calcium imaging or cAMP reporter assays in cells expressing OR10G9. Design the screening protocol using fractional factorial design to efficiently sample chemical space .

  • Structure-based virtual screening: Utilize the amino acid sequence of OR10G9 to build homology models for in silico docking studies with potential ligands. Prioritize compounds from virtual screening for experimental validation.

  • Chemoinformatic approaches: Analyze the chemical properties of known olfactory receptor ligands to identify potential OR10G9 ligands based on pattern recognition and machine learning algorithms.

  • Dose-response characterization: For identified hits, perform detailed dose-response studies to determine EC50 values and efficacy parameters.

  • Structure-activity relationship (SAR) studies: Systematically modify chemical structures of active compounds to map the binding pocket requirements and improve ligand affinity/selectivity.

The deorphanization strategy should incorporate controls for non-specific effects and validate findings across multiple experimental platforms to ensure reliable identification of true OR10G9 ligands.

What strategies can be employed to study the role of OR10G9 in non-olfactory tissues?

Olfactory receptors, including OR10G9, have been discovered to have functions beyond the olfactory epithelium. To investigate these roles:

  • Tissue expression profiling: Use qRT-PCR, RNA-seq, and immunohistochemistry with validated antibodies to map OR10G9 expression across diverse tissue types.

  • Conditional gene knockout models: Generate tissue-specific OR10G9 knockout models using Cre-lox technology to examine physiological consequences in specific tissues.

  • Primary cell isolation and culture: Establish cultures from tissues expressing OR10G9 to study receptor function in native cellular contexts.

  • Ex vivo tissue preparations: Use tissue slices or organ cultures to examine OR10G9 function while maintaining tissue architecture and cellular interactions.

  • Phenotypic screening: Employ loss-of-function (siRNA, CRISPR) and gain-of-function (overexpression) approaches in relevant cell types, followed by high-content phenotypic assays.

Experimental design should include appropriate controls and multiple methodological approaches to overcome challenges associated with typically low expression levels of olfactory receptors in non-olfactory tissues.

What statistical approaches are most appropriate for analyzing OR10G9 ligand screening data?

Analyzing OR10G9 ligand screening data requires robust statistical methods to distinguish true hits from false positives:

  • Z-factor analysis: Calculate Z' and Z-factors to assess assay quality and hit significance, with values >0.5 indicating excellent assay performance.

  • Multiple comparison corrections: Apply Bonferroni or false discovery rate (FDR) corrections when screening large compound libraries to control for type I errors.

  • Dose-response modeling: Fit dose-response data to appropriate models (four-parameter logistic model is often used) to determine EC50, Emax, and Hill coefficients.

  • Principal component analysis (PCA): Use PCA to identify patterns in multivariate response data that may indicate distinct modes of receptor activation.

  • Cluster analysis: Group compounds with similar activity profiles to identify structural classes of potential ligands.

Statistical workflows should be established prior to data collection, with clear criteria for hit selection and validation. Consider implementing factorial or response surface designs for more efficient exploration of complex parameter spaces in follow-up studies.

How can researchers address data inconsistencies in OR10G9 functional studies?

Data inconsistencies in OR10G9 functional studies may arise from various sources. A systematic troubleshooting approach includes:

  • Protein quality assessment: Verify protein integrity through SDS-PAGE and mass spectrometry to ensure full-length, properly folded receptor is being used.

  • Experimental variability analysis: Implement Design of Experiments (DOE) approaches to identify factors contributing to variability:

    • Full factorial designs to examine interaction effects

    • Fractional factorial designs for initial parameter screening

    • Box-Behnken or central composite designs for response surface optimization

  • Positive and negative controls: Include well-characterized olfactory receptors and inactive mutants as controls in every experiment.

  • Meta-analysis techniques: When integrating data across multiple studies or experimental runs, employ:

    • Random effects models to account for between-study variability

    • Standardized mean differences to compare results across different assay platforms

    • Sensitivity analyses to identify influential outliers

  • Reproducibility enhancement: Implement blinded analysis, multiple independent replicates, and pre-registered protocols to minimize bias and improve reliability.

What are the challenges and opportunities in developing OR10G9 as a potential therapeutic target?

OR10G9 represents a relatively unexplored target with potential therapeutic applications, presenting both challenges and opportunities:

Challenges:

  • Limited knowledge base: OR10G9 is classified as a target about which relatively little is known, with limited publications and characterized ligands .

  • Membrane protein complexity: As a GPCR, OR10G9 presents challenges in expression, purification, and structural characterization .

  • Selectivity concerns: The structural similarity between different olfactory receptors may complicate the development of highly selective compounds.

Opportunities:

  • Novel target space: OR10G9 represents relatively unexplored pharmacological territory, offering potential for intellectual property protection and novel mechanism therapeutics.

  • Advanced expression systems: Wheat germ expression systems have shown success in producing functional recombinant OR10G9 , providing a platform for further characterization.

  • Experimental design optimization: Application of systematic approaches like Box-Behnken and central composite designs can accelerate the optimization of assay conditions and screening parameters .

Researchers should consider collaborative approaches that combine medicinal chemistry expertise with advanced protein science and computational modeling to overcome the challenges associated with this target class.

How might computational approaches enhance OR10G9 research?

Computational approaches can significantly accelerate OR10G9 research through several methodologies:

  • Homology modeling and molecular dynamics: Generate 3D structural models of OR10G9 based on its amino acid sequence and available GPCR crystal structures. Refine these models through extensive molecular dynamics simulations to predict:

    • Ligand binding pockets

    • Conformational changes during activation

    • Key residues for receptor function

  • Virtual screening: Use structure-based (docking) and ligand-based (pharmacophore) approaches to screen virtual compound libraries, prioritizing candidates for experimental testing.

  • Machine learning applications:

    • Develop predictive models for OR10G9 ligand activity based on physicochemical properties

    • Use deep learning to identify patterns in functional response data

    • Apply network analysis to position OR10G9 within broader olfactory signaling networks

  • Design of Experiments (DOE) optimization: Apply computational DOE approaches to optimize experimental parameters with minimal laboratory work :

    • Response surface methodology for assay optimization

    • Fractional factorial designs for efficient parameter screening

    • Optimal design algorithms to maximize information gain while minimizing experiment count

These computational approaches should be integrated with experimental validation in an iterative cycle to continuously refine models and hypotheses about OR10G9 function.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.