Recombinant Human Olfactory receptor 10H1 (OR10H1)

Shipped with Ice Packs
In Stock

Description

Molecular Characterization

OR10H1 (UniProt ID: Q9Y4A9) consists of 318 amino acids with a canonical 7-transmembrane domain structure characteristic of GPCRs . Key features include:

PropertyDetail
Gene locationChromosome 19 (19p13.3)
Protein length318 amino acids
Molecular weight~35 kDa (predicted)
Post-translational modificationsGlycosylation sites at N-terminal extracellular domain

Recombinant Production Systems

Multiple platforms exist for recombinant OR10H1 production:

Expression SystemTagApplicationSource
HEK293 cellsNoneFunctional studies, ligand screeningCreative BioMart
E. coliHis-tagStructural analysis, antibody productionLSBio
Wheat germGST (N-Term)Conformational studies, in vitro assaysBio-Techne

The wheat germ system preserves native conformational folding critical for biological activity , while mammalian systems (HEK293) enable proper membrane localization .

Biochemical Functions

OR10H1 exhibits two primary activities :

  • G-protein coupled receptor activity: Triggers cAMP signaling via adenylyl cyclase 3 activation

  • Olfactory receptor activity: Specifically activated by sandalwood-related compounds (EC50 for Sandranol: ~50 μM)

Key interacting molecules:

  • ATP (secretion increased 2.1-fold upon activation)

  • Serotonin (release elevated 1.8-fold post-stimulation)

Pathway Involvement

OR10H1 participates in olfactory transduction and cancer-related pathways :

PathwayAssociated Proteins
Olfactory transductionOR52B6, CALML3, PRKG1, NCALD
Bladder cancer progressionβ-actin, T-cadherin, β-Catenin, IL-15

Oncological Significance in Bladder Cancer

Clinical studies demonstrate OR10H1's dual diagnostic/therapeutic potential:

Diagnostic biomarkers

  • Urinary OR10H1 mRNA levels:

    • Bladder cancer patients: 6.8-fold higher vs controls (p<0.001)

    • Sensitivity: 84%, Specificity: 79% in cohort studies

Therapeutic effects of activation
Sandranol (OR10H1 agonist) induces:

  • 62% reduction in BFTC905 cell viability (72h treatment)

  • G1 cell cycle arrest (45% increase vs baseline)

  • 58% decrease in migration capacity (scratch assay)

ParameterChangeMechanism
cAMP levels↑ 3.2-foldAC3-dependent pathway
Intracellular Ca²⁺↑ 180%Store-operated calcium entry
Apoptosis rate↑ 22%Caspase-3/7 activation

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will accommodate your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery timeframes.
Note: All proteins are shipped with standard blue ice packs. If dry ice shipping is required, please communicate with us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by factors such as storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize its development.
Synonyms
OR10H1; Olfactory receptor 10H1; Olfactory receptor OR19-27
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-318
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
OR10H1
Target Protein Sequence
MQRANHSTVTQFILVGFSVFPHLQLMLFLLFLLMYLFTLLGNLLIMATVWSERSLHTPMY LFLCALSVSEILYTVAIIPRMLADLLSTQRSIAFLACASQMFFSFSFGFTHSFLLTVMGY DRYVAICHPLRYNVLMSPRGCACLVGCSWAGGLVMGMVVTSAIFHLAFCGHKEIHHFACH VPPLLKLACGDDVLVVAKGVGLVCITALLGCFLLILLSYAFIVAAILKIPSAEGRNKAFS TCASHLTVVVVHYGFASVIYLKPKSPQSLEGDTLMGITYTVLTPFLSPIIFSLRNKELKV AMKKTFFSKLYPEKNVMM
Uniprot No.

Target Background

Function
Odorant receptor.
Database Links

HGNC: 8172

KEGG: hsa:26539

STRING: 9606.ENSP00000335596

UniGene: Hs.533925

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the genomic location and structure of OR10H1?

OR10H1 is located on chromosome 19p13.12 (NC_000019.10, positions 15,804,549 to 15,815,664, complement strand) . The gene contains 4 exons, although the coding sequence is typically contained within a single exon, as is characteristic of olfactory receptor genes . Like other ORs, OR10H1 encodes a protein with a 7-transmembrane domain structure typical of G-protein-coupled receptors that are responsible for the recognition and G protein-mediated transduction of signals .

How does the signaling mechanism of OR10H1 compare to canonical olfactory signaling?

OR10H1 follows the canonical olfactory signaling pathway involving adenylyl cyclase activation, leading to increased intracellular cAMP and subsequent calcium influx into the cell . Research has specifically identified adenylyl cyclase 3 as being involved in OR10H1 signaling . When activated by its ligand Sandranol, OR10H1 triggers a cascade that includes elevated cAMP levels (which can be reduced by adenylyl cyclase inhibition) and increased intracellular Ca²⁺ concentration . Additionally, OR10H1 activation enhances the secretion of ATP and serotonin, which may contribute to its functional effects in bladder cancer cells .

What methods are most effective for detecting OR10H1 expression in tissue samples?

Detection of OR10H1 in tissue samples can be effectively performed using both RNA-based and protein-based approaches:

RNA-based detection:

  • Reverse Transcriptase PCR (RT-PCR) using primers spanning both exons of OR10H1 to avoid artifacts from DNA contamination. The PCR product typically encompasses 269 bp .

  • RNA-Seq analysis, which has been successfully used to profile OR10H1 expression in bladder cancer tissues compared to normal tissues .

  • For reference gene normalization in qPCR experiments, TBP (TATA-box binding protein) has been used successfully, with relative expression calculated using the ΔCq method .

Protein-based detection:

  • Immunohistochemistry (IHC) using rabbit polyclonal anti-OR10H1 antibodies (such as those available from OriGene) at a dilution of 1:100 .

  • Immunocytochemistry (ICC) following standard protocols for GPCR detection .

How reliable is urine-based detection of OR10H1 transcripts as a non-invasive biomarker?

Research has demonstrated that OR10H1 transcripts are detectable at significantly higher levels in the urine of bladder cancer patients compared to control individuals, suggesting potential utility as a non-invasive biomarker . Significantly higher amounts of OR10H1 transcripts were detectable in the urine of bladder cancer patients than in the urine of control persons, making this approach promising for diagnostic applications .

For researchers implementing urine-based detection, several methodological considerations are important:

  • RNA isolation from urine requires careful handling to avoid degradation

  • Standardization of collection protocols is essential for reliable results

  • Normalization to appropriate reference genes is crucial for accurate quantification

  • Sensitivity and specificity values should be established for diagnostic applications

What expression patterns of OR10H1 have been observed across different bladder cancer tissues?

RNA-Seq data analysis has revealed distinctive expression patterns of OR10H1 across bladder cancer tissues. In a study of 25 bladder cancer samples, OR10H1 was expressed in 23 out of 25 bladder cancer tissue samples, with an average FPKM-value of 3.8, whereas it was only moderately expressed in normal bladder (n=5) with an average value of 0.3 . This difference in expression between healthy and cancerous tissue was statistically significant .

Data from the BioXpress database further indicated that OR10H1 showed the highest expression in bladder cancer tissues compared to 26 other cancer tissues, highlighting its relative specificity . None of the other 28 ranked olfactory receptors showed a similarly high expression in bladder cancer .

What ligands are known to activate OR10H1 and how were they identified?

Sandranol, a sandalwood-related compound that renders a typical sandal note, has been identified as a specific agonist of OR10H1 . The identification of this ligand (deorphanization) was accomplished using a Dual-Luciferase assay optimized for OR screening, as developed by Zhuang and Matsunami .

The methodological approach for OR10H1 ligand identification involved:

  • Construction of an expression plasmid containing OR10H1 as a fusion protein with an N-terminal rhodopsin tag

  • Transfection of Hana3A cells with the OR10H1 expression construct

  • Initial screening using Henkel 100, a diverse mixture containing multiple chemical classes (aliphatics, alcohols, aromatics, amines, alkanes, aldehydes, esters, ethers, ketones, heterocyclics) to ensure broad coverage of potential activators

  • Confirmation and concentration-dependent response analysis with individual compounds

  • Validation of specificity through comparison with other ORs and control experiments

What downstream signaling pathways are activated by OR10H1 stimulation?

OR10H1 activation by Sandranol initiates several intracellular signaling cascades:

  • cAMP Pathway: Sandranol application elevates cAMP levels in a concentration-dependent manner, which can be reduced by inhibition of adenylyl cyclase using inhibitors such as SQ22536 .

  • Calcium Signaling: OR10H1 activation elicits intracellular Ca²⁺ concentration increases, following the canonical olfactory signaling pathway .

  • Secretory Pathways: Activation enhances the secretion of ATP and serotonin, which may act as secondary messengers affecting surrounding cells .

  • Cytoskeletal Reorganization: OR10H1 stimulation leads to morphological changes apparent in cell rounding, accompanied by alterations in cytoskeletal components detected by β-actin, T-cadherin, and β-Catenin staining .

  • Cell Cycle Regulation: Cell cycle analysis revealed an increased G1 fraction following OR10H1 activation, suggesting effects on cell cycle checkpoints .

How does OR10H1 activation affect cellular processes in bladder cancer cells?

Activation of OR10H1 by Sandranol in bladder cancer cells induces several cellular and molecular changes with potential anti-tumorigenic effects:

  • Morphological Changes: Cell rounding is observed, accompanied by alterations in cytoskeletal architecture .

  • Reduced Cell Viability: Sandranol treatment significantly diminishes cell viability in bladder cancer cells (BFTC905) .

  • Antiproliferative Effects: Decreased cell proliferation is observed following OR10H1 activation .

  • Migration Inhibition: Cell migration is reduced upon Sandranol treatment .

  • Limited Apoptosis Induction: OR10H1 activation induces a limited degree of apoptosis .

  • Cell Cycle Arrest: Cell cycle analysis reveals an increased G1 fraction, suggesting cell cycle arrest at the G1/S checkpoint .

These effects collectively suggest that OR10H1 activation may have tumor-suppressive functions in bladder cancer cells.

How does OR10H1 compare with other olfactory receptors implicated in cancer?

Several olfactory receptors have been implicated in various cancers, with OR10H1 sharing some functional similarities but also displaying unique characteristics:

Olfactory ReceptorCancer TypeLigandEffects upon ActivationReference
OR10H1Bladder cancerSandranolReduced proliferation, migration; increased G1 arrest; limited apoptosis
OR51E2Prostate cancerβ-IononDiminished proliferation and migration
OR2J3Lung cancerHelionalReduced cell proliferation
OR2AT4LeukemiaSandaloreInduced apoptosis
OR1A2Hepatocellular carcinoma(-)-CitronellolReduced cell proliferation
OR51B4Colorectal cancerTroenanReduced proliferation and migration; induced apoptosis
OR7C1Colorectal cancerUnknownMarker of cancer-initiating cells

OR10H1 appears to be relatively unique in its high specificity for bladder tissue and bladder cancer . While other ORs like OR51E1 and OR51E2 have been identified as potential biomarkers in multiple cancer types (prostate, lung, small intestine), OR10H1 shows more tissue-specific expression according to available data .

What evidence supports OR10H1 as a potential biomarker for bladder cancer?

Multiple lines of evidence support OR10H1 as a promising biomarker for bladder cancer:

  • Differential Expression: OR10H1 shows significantly higher expression in bladder cancer tissues (average FPKM-value of 3.8 in 23/25 samples) compared to normal bladder tissue (average FPKM-value of 0.3) .

  • Tissue Specificity: According to GTex data, OR10H1 is prominently expressed in the bladder but minimally expressed in other tissues, providing specificity for bladder-related conditions .

  • Urine Detection: OR10H1 transcripts are detectable at significantly higher levels in the urine of bladder cancer patients compared to control individuals, suggesting potential for non-invasive diagnostics .

  • Cancer Specificity: OR10H1 shows the highest expression in bladder cancer tissues compared to 26 other cancer tissues, suggesting specificity for bladder cancer rather than as a general cancer marker .

What methodological approaches are recommended for studying OR10H1 in functional assays?

For comprehensive functional characterization of OR10H1, several complementary methodological approaches are recommended:

  • Receptor Activation Studies:

    • Dual-Luciferase Reporter Assay: Optimized for OR screening by Zhuang and Matsunami, this assay is effective for ligand identification and dose-response studies

    • cAMP Assays: To quantify changes in cAMP levels, with optional adenylyl cyclase inhibitors (such as SQ22536) to confirm pathway specificity

    • Calcium Imaging: To measure intracellular calcium flux upon receptor activation

  • Cellular Response Assays:

    • Morphological Analysis: Immunocytochemistry using Phalloidin for β-actin staining (1:100 dilution), anti-CadherinT antibody (1:50 dilution), and β-Catenin staining

    • Proliferation Assays: To measure cell growth inhibition following receptor activation

    • Migration Assays: To assess effects on cell motility

    • Cell Cycle Analysis: Flow cytometry to determine cell cycle distribution changes

    • Apoptosis Detection: To quantify cell death induction

  • Secretion Assays:

    • ATP Release Measurement: To quantify ATP secretion following OR10H1 activation

    • Serotonin Quantification: To measure serotonin release

What are key considerations for OR10H1 transfection and expression in cell lines?

When designing experiments involving OR10H1 transfection and expression, researchers should consider:

  • Plasmid Construction:

    • Construct an expression plasmid containing OR10H1 as a fusion protein with an N-terminal rhodopsin tag to enhance membrane localization and detection

    • Use standard PCR methods to construct rho-tagged pCI expression vectors coding for OR10H1

  • Cell Line Selection:

    • Hana3A cells have been successfully used for OR deorphanization studies

    • BFTC905 bladder cancer cells have been used for functional characterization

    • Consider using bladder cancer cell lines with varying endogenous OR10H1 expression levels

  • Expression Verification:

    • Immunocytochemistry using mouse monoclonal α-Rhodopsin 4D2 antibody (AR441, Dako, 1:100 dilution) to detect the tagged receptor

    • RT-PCR spanning both exons of OR10H1 to confirm mRNA expression

  • Controls:

    • Include empty vector controls

    • Use cells expressing unrelated ORs as specificity controls

    • Consider using OR10H1 knockdown/knockout cells as negative controls

How should researchers design experiments to validate OR10H1 as a biomarker in clinical samples?

For clinical validation of OR10H1 as a biomarker, researchers should implement a rigorous experimental design:

  • Sample Collection and Processing:

    • Standardize collection protocols for tissue and urine specimens

    • Implement appropriate preservation methods to maintain RNA integrity

    • Include patient demographic and clinical information for correlation analysis

  • Detection Methods:

    • For tissue samples: Use both RT-PCR/qPCR and immunohistochemistry for multi-level validation

    • For urine samples: Optimize RNA extraction and develop sensitive RT-qPCR protocols

    • Consider developing ELISA or other protein-based detection methods

  • Study Design:

    • Include adequate sample sizes with appropriate statistical power

    • Incorporate diverse patient populations and disease stages

    • Use matched normal/tumor samples when possible

    • Include other bladder cancer biomarkers for comparative analysis

  • Validation Cohorts:

    • Use independent patient cohorts for validation

    • Consider multi-center studies to account for geographic and demographic variations

    • Correlate biomarker findings with clinical outcomes

  • Data Analysis:

    • Establish sensitivity, specificity, positive predictive value, and negative predictive value

    • Perform ROC curve analysis to determine optimal cutoff values

    • Evaluate biomarker performance in combination with standard clinical parameters

What protocols are recommended for investigating OR10H1 signaling mechanisms?

To elucidate OR10H1 signaling mechanisms comprehensively, researchers should employ multiple complementary approaches:

  • G-protein Coupling Analysis:

    • Use specific G-protein inhibitors to determine which G-protein subtypes couple to OR10H1

    • Employ BRET or FRET assays to directly measure receptor-G-protein interactions

    • Validate canonical olfactory signaling pathway components (adenylyl cyclase, cAMP)

  • Second Messenger Assays:

    • Measure cAMP levels using ELISA or luminescence-based assays following stimulation with Sandranol at various concentrations

    • Add adenylyl cyclase inhibitors (e.g., SQ22536) to confirm pathway specificity

    • Quantify calcium flux using fluorescent calcium indicators

  • Downstream Pathway Analysis:

    • Perform phosphoprotein profiling to identify activated signaling intermediates

    • Use pathway-specific inhibitors to dissect the contribution of different signaling branches

    • Investigate cross-talk with other signaling pathways important in bladder cancer

  • Secretome Analysis:

    • Quantify ATP and serotonin release following OR10H1 activation

    • Perform broader secretome analysis to identify additional released factors

    • Investigate autocrine/paracrine effects of secreted molecules

  • Cytoskeletal Dynamics:

    • Analyze β-actin, T-cadherin, and β-Catenin redistribution using time-lapse microscopy

    • Quantify changes in cell adhesion molecules and cytoskeletal components

    • Correlate cytoskeletal changes with functional outcomes (migration, invasion)

What are the current knowledge gaps regarding OR10H1 function in bladder cancer?

Despite promising findings, several important knowledge gaps remain in OR10H1 research:

  • Physiological Role: The normal physiological function of OR10H1 in healthy bladder tissue remains poorly understood .

  • Regulatory Mechanisms: The factors controlling OR10H1 expression in bladder tissue (both normal and cancerous) have not been fully elucidated .

  • Endogenous Ligands: While Sandranol has been identified as an exogenous agonist, potential endogenous ligands that may activate OR10H1 in the bladder microenvironment remain unknown .

  • Signaling Network Integration: How OR10H1 signaling integrates with other cancer-relevant pathways is not fully characterized .

  • Prognostic Value: The correlation between OR10H1 expression levels and patient outcomes, including treatment response and survival, requires larger cohort studies .

  • Genetic Variations: The impact of OR10H1 polymorphisms on receptor function and bladder cancer susceptibility has not been adequately studied .

  • Structural Information: Detailed molecular structure of OR10H1 and its interaction with ligands would facilitate rational drug design .

How might OR10H1 be developed as a therapeutic target for bladder cancer?

Based on the finding that OR10H1 activation by Sandranol produces anti-tumorigenic effects in bladder cancer cells, several therapeutic approaches could be developed:

  • Agonist-Based Therapies:

    • Optimization of Sandranol derivatives with improved pharmacokinetic properties

    • Development of targeted delivery systems for localized activation in the bladder

    • Combination of OR10H1 agonists with conventional chemotherapeutics to enhance efficacy

  • Diagnostic Applications:

    • Development of OR10H1-based urine tests for non-invasive bladder cancer detection

    • Use of OR10H1 expression analysis in tissue biopsies for diagnostic confirmation

    • Monitoring of OR10H1 levels during treatment and follow-up

  • Therapeutic Delivery Strategies:

    • Intravesical delivery of OR10H1 agonists to maximize local effects and minimize systemic exposure

    • Nanoparticle encapsulation for improved stability and controlled release

    • Combination with bladder cancer immunotherapy approaches

  • Mechanistic Targeting:

    • Development of compounds that enhance the anti-proliferative and pro-apoptotic effects of OR10H1 activation

    • Targeting of downstream effectors in the OR10H1 signaling pathway

    • Leveraging OR10H1-induced secretion of ATP and serotonin for therapeutic benefit

What interdisciplinary approaches might advance OR10H1 research?

Advancing OR10H1 research in bladder cancer would benefit from interdisciplinary collaborations:

  • Structural Biology and Computational Modeling:

    • Determine the three-dimensional structure of OR10H1

    • Use computational approaches to screen virtual libraries for novel agonists

    • Apply molecular dynamics simulations to understand ligand-receptor interactions

  • Chemical Biology:

    • Develop chemical probes for studying OR10H1 function

    • Create photoaffinity labels to identify binding sites

    • Design biased ligands that selectively activate beneficial signaling pathways

  • Biomarker Development:

    • Integrate OR10H1 into multi-biomarker panels for improved diagnostic performance

    • Develop point-of-care testing platforms for OR10H1 detection in urine

    • Correlate OR10H1 expression with genomic and proteomic profiles

  • Systems Biology:

    • Map the OR10H1 signaling network in bladder cancer

    • Identify feedback mechanisms and pathway cross-talk

    • Model the dynamic responses to OR10H1 activation in different cellular contexts

  • Translational Research:

    • Develop patient-derived xenograft models expressing OR10H1

    • Conduct preclinical studies of OR10H1 agonists in animal models

    • Design early-phase clinical trials to test safety and efficacy of OR10H1-targeted therapeutics

These interdisciplinary approaches would collectively advance understanding of OR10H1 biology and accelerate its development as both a biomarker and therapeutic target in bladder cancer.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.