Recombinant Human Olfactory receptor 10H3 (OR10H3)

Shipped with Ice Packs
In Stock

Description

Recombinant Production Methods

OR10H3 is expressed in heterologous systems to enable structural and functional studies:

Expression Systems

HostAdvantagesYield
HEK293 cellsProper folding and post-translational modifications~1.6 mg (monomer) per 60 flasks
BaculovirusHigh-yield production for large-scale studies>85% purity
  • Nanodisc Stabilization: Full-length OR10H3 is purified in synthetic nanodiscs to mimic native lipid environments, enhancing stability for biophysical assays .

  • Lyophilization: Proteins are lyophilized with trehalose to maintain activity during storage .

Purification and Analysis

  • Two-Step Purification: Immunoaffinity chromatography (anti-Flag) followed by gel filtration isolates monomeric and dimeric forms .

  • Biophysical Validation: Circular dichroism confirms proper folding, while tryptophan fluorescence assays detect ligand-binding potential .

Research Applications

OR10H3 is utilized in diverse experimental contexts:

ApplicationMethodRelevance
Drug DiscoveryHigh-throughput ligand screeningIdentifies agonists/antagonists for therapy
Structural BiologyCryo-EM or X-ray crystallographyResolves activation mechanisms
Cancer ResearchReceptor profiling in tumorsExplores roles in bladder or prostate cancer

Challenges and Future Directions

  • Deorphanization: Current databases (e.g., M2OR) lack OR10H3-odorant pairs, necessitating high-throughput screening .

  • Therapeutic Potential: ORs like OR10H1 in bladder cancer show odorant-induced anti-proliferative effects, suggesting similar pathways for OR10H3 .

  • In Vivo Studies: Role in non-olfactory tissues (e.g., sperm chemotaxis or immune modulation) remains unexplored .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. If you have specific format requirements, please indicate them during order placement, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. For precise delivery timelines, please consult your local distributors.
Note: All of our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to concentrate the contents. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life is influenced by multiple factors such as storage condition, buffer ingredients, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
OR10H3; Olfactory receptor 10H3; Olfactory receptor OR19-24
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-316
Protein Length
Full length protein
Species
Homo sapiens (Human)
Target Names
OR10H3
Target Protein Sequence
MPGQNYRTISEFILSGFSAFPQQLLPVLFLLYLLMFLFTLLGNLLIMATVWIERRLHTPM YLFLCALSISEILFTVAITPRMLADLLFTHRSITFVACAIQMFFSFMFGFTHSFLLMVMG YDHYVTICHPLHYNMLMSPRGCAHLVAWTWAGGSVMGMMVTMMVFHLTFCGSNVIHHFLC HVLSLLKLACGSKTSSVIMGVMLVCVTALIGCLFLIILSFVFIVAAILRIPSAEGRHKTF STCVSHLTVVVMHYSFASLIYLKPKGLHSMYSDALMATTYTVFTPFLSPIIFSLRNKELK NAINKNFCRRFCPLSS
Uniprot No.

Target Background

Function
Odorant receptor.
Database Links

HGNC: 8174

KEGG: hsa:26532

STRING: 9606.ENSP00000307130

UniGene: Hs.553524

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Olfactory Receptor 10H3 and what is its role in human olfaction?

Olfactory receptor 10H3 is a protein encoded by the OR10H3 gene in humans. Like other olfactory receptors, OR10H3 belongs to the large family of G-protein-coupled receptors (GPCRs) arising from single coding-exon genes. These receptors interact with odorant molecules in the nasal epithelium, initiating neuronal responses that trigger smell perception .

The human olfactory system contains approximately 400 different olfactory receptors, creating a complex repertoire of responses that enables discrimination between thousands of different odorants . OR10H3, as part of this system, contributes to the combinatorial coding of odors, where each odorant activates a unique pattern of olfactory receptors, and each receptor can respond to multiple odorants with varying intensities.

What is the molecular structure of OR10H3 and how does it compare to other olfactory receptors?

OR10H3 shares the characteristic 7-transmembrane domain structure common to olfactory receptors and many neurotransmitter and hormone receptors . This structure consists of seven α-helical segments that span the cell membrane, connected by alternating intracellular and extracellular loops. The transmembrane domains form a binding pocket for odorant molecules, while the intracellular portions interact with G-proteins to trigger signal transduction.

The sequence homology analysis of OR10H3 places it within Class II (tetrapod-specific) olfactory receptors, distinguishing it from Class I (fish-like) receptors . While the exact three-dimensional structure of OR10H3 has not been experimentally determined at atomic resolution (as is the case for most GPCRs), computational models based on homology to crystallized GPCRs can provide insights into its likely structural features.

How is the OR10H3 gene expressed and regulated in olfactory neurons?

The OR10H3 gene, like other olfactory receptor genes, follows the "one neuron-one receptor" rule, where each olfactory sensory neuron expresses predominantly one olfactory receptor type. This expression is regulated through a complex mechanism involving:

  • Chromatin remodeling and epigenetic modifications

  • Transcription factors specific to olfactory neurogenesis

  • Feedback mechanisms that suppress the expression of other olfactory receptor genes once one is successfully expressed

Expression challenges common to olfactory receptors also apply to OR10H3. In heterologous systems, olfactory receptors are often poorly expressed on the cell surface due to inefficient trafficking from the endoplasmic reticulum . Research indicates that increasing transcriptional efficiency through systems like TAR-Tat can significantly improve both cell surface expression and functional activity of human olfactory receptors .

What are the optimal expression systems for producing functional recombinant OR10H3?

The expression of functional olfactory receptors in heterologous systems presents significant challenges. Based on research with other human olfactory receptors, several expression systems can be considered for OR10H3:

Expression SystemAdvantagesLimitationsSuitability for OR10H3
HEK293 cellsMammalian post-translational modifications, efficient transfectionModest protein yieldsGood for functional studies
Wheat germ cell-freeHigh yield, fewer aggregation issuesLacks mammalian post-translational modificationsSuitable for structural studies
Insect cellsHigher expression than mammalian cells, some post-translational modificationsMore complex than bacterial systemsGood compromise option
Yeast (S. cerevisiae)GPCR expression capability, eukaryotic processingDifferent membrane compositionRequires optimization

For optimal expression of functional OR10H3, a mammalian expression system using the TAR-Tat enhancement system has shown promise with other olfactory receptors. This approach increases transcriptional efficiency through positive feedback, resulting in improved cell surface expression and functional response to odorants .

How can the TAR-Tat system be implemented to enhance OR10H3 expression?

The TAR-Tat system represents a significant advancement for expressing challenging membrane proteins like olfactory receptors. Implementation for OR10H3 expression would involve the following methodology:

  • Cloning the OR10H3 coding sequence into a vector containing the TAR (Trans-Activation Response) element

  • Co-expressing the HIV Tat protein, which binds to TAR and enhances transcription

  • Establishing a positive feedback loop where increased expression leads to further transcriptional enhancement

This system has demonstrated robust expression improvements for olfactory receptors OR1A1, OR6N2, and OR51M1, with significant enhancement of their functional responses to odorants . For OR10H3, this approach could overcome the common challenge of poor heterologous expression.

The experimental protocol would include:

  • Transfecting cells with both OR10H3-TAR construct and Tat expression vector

  • Validating expression using immunocytochemistry or flow cytometry

  • Confirming functionality through calcium imaging or cAMP assays

  • Comparative analysis with conventional expression systems

What experimental designs are most appropriate for studying OR10H3 ligand interactions?

Experimental design is crucial for accurately characterizing OR10H3-ligand interactions. A randomized controlled experimental design provides the most reliable results for determining causality in receptor-ligand interaction studies .

For OR10H3 research, consider these experimental designs:

The selection of an appropriate design depends on the specific research question, available resources, and technical constraints. For initial characterization of OR10H3 ligands, a dose-response design with proper controls would be most informative.

How can computational models be used to predict OR10H3 binding properties?

Computational modeling of OR10H3 binding properties involves several sophisticated approaches:

  • Homology Modeling: Creating a 3D structural model of OR10H3 based on related GPCRs with known crystal structures, optimized for the unique features of olfactory receptors.

  • Molecular Docking: Using computational algorithms to predict the binding orientation and affinity of potential ligands within the OR10H3 binding pocket.

  • Molecular Dynamics Simulations: Simulating the dynamic behavior of the OR10H3-ligand complex over time to evaluate stability and conformational changes.

  • Machine Learning Approaches: Training models on existing olfactory receptor-ligand interaction data to predict binding profiles. This approach has been successfully applied to antibody specificity prediction and could be adapted for olfactory receptors .

A biophysics-informed model combining extensive experimental data with computational analysis can identify different binding modes associated with particular ligands . For OR10H3, this could involve:

  • Collecting data from phage display experiments with OR10H3 against multiple potential ligands

  • Identifying sequence patterns associated with binding to specific ligands

  • Developing a quantitative model that predicts binding affinity based on sequence and structural features

Such models can disentangle binding modes even for chemically similar ligands, allowing for the computational design of OR10H3 variants with customized specificity profiles .

What are the challenges in determining OR10H3 specificity and how can they be overcome?

Determining the specificity profile of OR10H3 faces several significant challenges:

  • Chemical similarity of odorants: Olfactory receptors often need to discriminate between structurally similar molecules, requiring high-precision experimental approaches.

  • Expression limitations: Poor heterologous expression can mask true receptor responses or introduce artifacts.

  • Coupling mechanisms: Variations in G-protein coupling efficiency can affect signal transduction independent of binding affinity.

  • Concentration-dependent responses: Olfactory receptors may respond differently to the same odorant at different concentrations.

These challenges can be addressed through:

  • Enhanced expression systems: Implementing the TAR-Tat system to increase transcriptional efficiency and functional expression .

  • Multiple assay formats: Combining direct binding assays with functional calcium imaging or cAMP assays to generate a comprehensive specificity profile.

  • Selection-based approaches: Adapting methods from antibody research, such as phage display with one immobilized target ligand in the presence of soluble non-targeted ligands .

  • Biophysical characterization: Using techniques like surface plasmon resonance (SPR) or isothermal titration calorimetry (ITC) to directly measure binding affinity and kinetics.

  • Cross-validation: Testing OR10H3 responses in multiple cell types and expression systems to identify consistent ligand interactions.

How does OR10H3 signaling integrate with the broader olfactory perception system?

OR10H3 signaling integration is a complex process involving multiple levels of neural processing:

  • Signal Initiation: Upon odorant binding, OR10H3 undergoes conformational changes that activate G-protein (Golf), leading to increased adenylyl cyclase activity and cAMP production.

  • Signal Amplification: The cAMP opens cyclic nucleotide-gated (CNG) channels, causing calcium influx and membrane depolarization.

  • Glomerular Convergence: Neurons expressing OR10H3 project axons that converge on specific glomeruli in the olfactory bulb, creating a spatial map of receptor activation.

  • Temporal Coding: The timing of OR10H3 activation relative to other receptors contributes to odor perception through temporal coding mechanisms.

  • Central Processing: Signals from OR10H3-expressing neurons undergo processing in the olfactory cortex, where they integrate with inputs from other receptor types.

Understanding this integration requires multi-level experimental approaches:

  • Single-cell recordings from OR10H3-expressing neurons

  • Calcium imaging of glomerular responses

  • Functional MRI studies during controlled odorant exposure

  • Behavioral studies correlating OR10H3 activation with perception

What are the most effective methods to validate the functionality of recombinant OR10H3?

Validating recombinant OR10H3 functionality requires a multi-faceted approach:

  • Expression Validation:

    • Western blotting to confirm protein expression

    • Immunocytochemistry to verify membrane localization

    • Flow cytometry to quantify surface expression levels

  • Functional Validation:

    • Calcium imaging to detect ligand-induced responses

    • cAMP assays to measure G-protein coupling and activation

    • BRET/FRET assays to monitor conformational changes upon ligand binding

  • Ligand Binding Validation:

    • Competitive binding assays with known odorants

    • Dose-response curves to establish EC₅₀/IC₅₀ values

    • Binding kinetics using biophysical methods (SPR, ITC)

A comprehensive validation protocol might include:

Validation LevelTechniqueExpected Outcome for Functional OR10H3
ExpressionWestern blotBand at ~35-40 kDa
LocalizationImmunofluorescenceMembrane localization (non-permeabilized)
Surface expressionFlow cytometry>10% positive cells with surface staining
Functional couplingcAMP assay>2-fold increase upon agonist stimulation
Ligand responseCalcium imagingDose-dependent response to cognate ligands
SpecificityCompetitive bindingDisplacement by structurally related odorants

How can the cell surface expression of OR10H3 be optimized in heterologous systems?

Optimizing cell surface expression of OR10H3 requires addressing the trafficking limitations common to olfactory receptors. Several strategies can be employed:

  • Transcriptional Enhancement:

    • Implementation of the TAR-Tat system to increase transcription efficiency through positive feedback mechanisms

    • Use of strong, cell-type appropriate promoters

  • Trafficking Enhancement:

    • Co-expression with receptor transporting proteins (RTPs) and receptor expression enhancing proteins (REEPs)

    • Addition of N-terminal trafficking tags derived from better-expressed GPCRs

    • Inclusion of rhodopsin-derived sequences to enhance membrane targeting

  • Post-translational Modifications:

    • Selection of expression systems that provide appropriate glycosylation

    • Mutation of problematic residues that may cause ER retention

  • Culture Conditions Optimization:

    • Reduced temperature cultivation (30-32°C) to slow protein synthesis and improve folding

    • Addition of chemical chaperones like glycerol or DMSO

    • Use of specific growth media supplements

Experimental evidence with other human olfactory receptors has shown that increasing transcriptional efficiency through the TAR-Tat system significantly improved both cell surface expression and functional response to odorants . Applying this approach to OR10H3 could overcome expression limitations and enable more robust functional studies.

What analytical techniques provide the most reliable data on OR10H3-ligand interactions?

Reliable characterization of OR10H3-ligand interactions requires complementary analytical techniques:

  • Functional Assays:

    • Calcium imaging: Provides real-time visualization of receptor activation in single cells

    • cAMP assays: Measures downstream signaling, indicating functional coupling

    • Electrophysiology: Records membrane current changes with high temporal resolution

  • Binding Assays:

    • Radioligand binding: Quantifies direct binding with high sensitivity

    • Surface plasmon resonance (SPR): Measures binding kinetics in real-time

    • Isothermal titration calorimetry (ITC): Provides thermodynamic parameters of binding

  • Structural Approaches:

    • Hydrogen-deuterium exchange mass spectrometry (HDX-MS): Maps conformational changes upon ligand binding

    • Molecular dynamics simulations: Predicts binding modes and conformational effects

    • Site-directed mutagenesis: Identifies critical residues for binding specific ligands

A comprehensive research strategy should combine these approaches to generate converging evidence. For example, calcium imaging might identify potential ligands, which can then be confirmed through direct binding assays and further characterized by mutagenesis studies.

The most reliable analytical approach would implement experimental designs with appropriate controls, as outlined in the experimental design section , ensuring that observed effects can be confidently attributed to specific OR10H3-ligand interactions.

What are the emerging technologies that could advance OR10H3 research?

Emerging technologies with significant potential for OR10H3 research include:

  • Single-cell transcriptomics: Profiling gene expression in individual olfactory neurons to understand the regulatory context of OR10H3 expression.

  • Cryo-electron microscopy: Potentially resolving the structure of OR10H3 in different conformational states, providing insights into activation mechanisms.

  • Artificial intelligence approaches: Leveraging machine learning to predict OR10H3 ligands based on structural features, similar to approaches used in antibody specificity prediction .

  • Organoid technology: Developing olfactory epithelium organoids that express OR10H3 in a more physiologically relevant context.

  • Genome editing: Using CRISPR-Cas9 to create precise modifications to study structure-function relationships in OR10H3.

  • Biosensor development: Creating OR10H3-based biosensors for detecting specific odorants with high sensitivity and specificity.

These technologies could fundamentally transform our understanding of OR10H3 function and olfactory perception more broadly, enabling research questions that were previously inaccessible.

How might understanding OR10H3 contribute to broader neuroscience and drug discovery research?

Research on OR10H3 has implications extending beyond olfaction:

  • GPCR structure and function: As a member of the largest GPCR subfamily, insights from OR10H3 can inform our understanding of GPCR activation mechanisms relevant to drug targets.

  • Neural coding principles: The combination of specificity and promiscuity in olfactory receptors provides a model system for studying how sensory information is encoded in the brain.

  • Drug delivery systems: Olfactory receptors offer potential routes for drug delivery to the brain, bypassing the blood-brain barrier.

  • Biosensor applications: OR10H3-based biosensors could be developed for environmental monitoring, food safety, or medical diagnostics.

  • Evolutionary neuroscience: Comparative studies of OR10H3 across species can reveal evolutionary adaptations in sensory systems.

Understanding the relationship between OR10H3 sequence, structure, and specificity could inform computational approaches to protein engineering more broadly, including the design of proteins with tailored specificity profiles for therapeutic applications .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.