Recombinant Human Olfactory receptor 10J1 (OR10J1)

Shipped with Ice Packs
In Stock

Description

Ligand Specificity

OR10J1 was deorphanized using calcium imaging assays, showing activation by dimetol (a menthol derivative) . This ligand-receptor interaction induces intracellular Ca²⁺ signaling, critical for downstream physiological responses.

Cellular Localization in Spermatozoa

Immunocytochemical studies localize OR10J1 to:

  • Midpiece (energy-producing mitochondrial region)

  • Flagellar principal piece (motility-related structure)

This spatial distribution suggests roles in sperm chemotaxis and motility regulation .

Antibody Validation and Research Tools

Antibodies targeting recombinant OR10J1 (e.g., Boster Bio A15013) are validated for:

ApplicationDetails
Western Blot (WB)Detects ~36 kDa band in transfected cell lysates
ImmunocytochemistryLocalizes OR10J1 in sperm flagella and midpiece
ELISAQuantifies OR10J1 in biological samples (detection range: 0.156–10 ng/ml)

Specificity is confirmed using blocking peptides and recombinant protein controls .

Olfactory Mechanism Studies

  • OR10J1 contributes to odorant discrimination via combinatorial coding, where multiple receptors respond to overlapping odor sets .

  • Metal ion interactions (e.g., copper) may modulate ligand binding, as observed in related olfactory receptors .

Reproductive Biology

  • In spermatozoa, OR10J1 activation by odorants like dimetol triggers Ca²⁺ influx, potentially influencing navigation toward egg-derived chemoattractants .

  • Co-expression with other sperm ORs (e.g., OR2H1, OR2W3) suggests a coordinated chemosensory network .

Challenges and Future Directions

  • Structural Biology: No resolved 3D structures exist for OR10J1; homology modeling relies on conserved GPCR motifs .

  • Antisense Transcripts: OR10J1-associated antisense RNAs in spermatozoa (e.g., overlapping exon-intron structures) require functional characterization .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that is currently in stock. However, if you have any specific format requirements, please indicate them in your order notes, and we will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery time information.
Note: All our proteins are shipped with standard blue ice packs by default. If dry ice shipping is required, please inform us in advance, and additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C, and aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
OR10J1; Olfactory receptor 10J1; Olfactory receptor OR1-26; Olfactory receptor-like protein HGMP07J
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-320
Protein Length
Full length protein
Species
Homo sapiens (Human)
Target Names
OR10J1
Target Protein Sequence
MLLCFRFGNQSMKRENFTLITDFVFQGFSSFHEQQITLFGVFLALYILTLAGNIIIVTII RMDLHLHTPMYFFLSMLSTSETVYTLVILPRMLSSLVGMSQPISLAGCATQMFFFVTFGI TNCFLLTAMGYDRYVAICNPLRYMVIMNKRLRIQLVLGACSIGLIVAITQVTSVFRLPFC ARKVPHFFCDIRPVMKLSCIDTTVNEILTLIISVLVLVVPMGLVFISYVLIISTILKIAS VEGRKKAFATCASHLTVVIVHYSCASIAYLKPKSENTREHDQLISVTYTVITPLLNPVVY TLRNKEVKDALCRAVGGKFS
Uniprot No.

Target Background

Function
Odorant receptor.
Database Links

HGNC: 8175

KEGG: hsa:26476

STRING: 9606.ENSP00000399078

UniGene: Hs.532661

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is OR10J1 and what protein family does it belong to?

OR10J1 is a human olfactory receptor that belongs to the G-protein coupled receptor 1 family. Like other olfactory receptors, OR10J1 functions as an odorant receptor capable of detecting specific chemical compounds. Structurally, OR10J1 contains the characteristic seven-transmembrane domain architecture typical of G-protein coupled receptors, with specific binding sites that determine its ligand specificity. OR10J1 is one of approximately 400 functional olfactory receptors in the human genome that enables the detection of various chemical substances .

Where is OR10J1 expressed in human tissues?

OR10J1 shows high and specific transcript and protein expression in human spermatozoa. Immunocytochemical staining experiments have demonstrated that OR10J1 is primarily localized to the midpiece and flagellum regions of human spermatozoa. This specific localization pattern suggests a potential functional role of OR10J1 in sperm physiology beyond traditional olfactory functions. RNA-Seq analysis has confirmed the presence of OR10J1 transcripts in both human spermatozoa and testis, indicating that this receptor's expression is largely confined to the male reproductive system .

How was OR10J1 identified in human spermatozoa?

OR10J1 was identified through comprehensive transcriptome analysis of human spermatozoa using RNA-Seq technology. The study analyzed RNA from multiple sperm samples and compared the expression profiles with other reference tissues including brain, colon, liver, lung, and skeletal muscle. The analysis revealed that OR10J1 is among approximately 90 putative OR transcripts detected in human spermatozoa, with most of these transcripts being exclusively found in sperm and testis tissues, suggesting specialized functions in reproductive biology .

What are the recommended protocols for cloning and expressing OR10J1?

To clone and express OR10J1 for research purposes, the following methodology is recommended:

  • Amplification of the complete OR10J1 open reading frame from human genomic DNA using PCR with specific primer pairs containing appropriate restriction sites (e.g., EcoRI and NotI or NotI and ApaI).

  • Subcloning the amplified sequence into an expression vector such as pCI plasmid (Promega), which can be modified to include an N-terminal rhodopsin tag (rho-tag, first 20 amino acids of rhodopsin) to enhance membrane trafficking.

  • Verification of the plasmid constructs and PCR products by Sanger sequencing to ensure sequence accuracy.

  • Transfection of the construct into a suitable cell line like Hana3A cells (specifically designed for OR expression) using a standard calcium phosphate precipitation technique, with approximately 0.5 μg of plasmid DNA for 48 hours.

This approach has been successfully employed for the heterologous expression of OR10J1 and other ORs, enabling functional characterization and deorphanization studies .

How can the activation of OR10J1 be measured in experimental settings?

The activation of OR10J1 can be effectively measured using calcium imaging techniques. The protocol involves:

  • Expressing recombinant OR10J1 in Hana3A cells, which provide the necessary molecular machinery for OR signaling.

  • Loading the transfected cells with calcium-sensitive fluorescent dyes (e.g., Fura-2/AM).

  • Exposing the cells to potential ligands or odorant mixtures while monitoring changes in intracellular calcium concentration using fluorescence microscopy.

  • Analyzing the calcium signal amplitude and kinetics to determine receptor activation.

  • Including appropriate controls such as mock-transfected cells to verify that the observed responses are specifically mediated by OR10J1.

This methodology has been successfully employed to identify dimetol as a specific agonist for OR10J1, with the receptor showing significant calcium responses when exposed to this odorant .

What immunocytochemical approaches are effective for localizing OR10J1 in human spermatozoa?

For the immunocytochemical detection of OR10J1 in human spermatozoa, the following protocol has proven effective:

  • Collection and preparation of purified human sperm samples.

  • Incubation of sperm in Ringer's solution and placement on poly-L-lysine-coated cover slips.

  • Fixation with 4% paraformaldehyde to preserve cellular structures.

  • Permeabilization of the fixed cells with PBS containing an appropriate detergent to allow antibody access.

  • Incubation with validated α-OR10J1 primary antibodies, followed by fluorescently labeled secondary antibodies.

  • Counterstaining with DAPI to visualize cell nuclei and establish cell orientation.

  • Examination using fluorescence microscopy with different focal planes to accurately determine the subcellular localization.

This approach has revealed that OR10J1 is primarily localized to the midpiece of human spermatozoa, suggesting a potential role in sperm function beyond olfaction .

What is known about the ligand specificity of OR10J1?

Deorphanization studies have identified dimetol as a specific agonist for OR10J1. When expressed in Hana3A cells, OR10J1 showed significant calcium responses upon exposure to dimetol, while mock-transfected control cells showed no such response. This ligand specificity was established through systematic screening with different odorant mixtures followed by individual compound testing.

The identification of dimetol as an OR10J1 agonist provides important insights into the receptor's binding pocket characteristics and structural preferences. This information is valuable for understanding the molecular basis of OR10J1 activation and for designing experiments to further investigate its physiological functions .

What signaling pathways are activated downstream of OR10J1 in spermatozoa?

Upon activation, OR10J1 appears to modulate intracellular calcium signaling in spermatozoa. While the complete signaling cascade remains to be fully elucidated, the following pathway components are likely involved:

  • G-protein coupling following ligand binding to OR10J1

  • Activation of adenylyl cyclase and subsequent increase in cAMP levels

  • Activation of protein kinase A (PKA)

  • Opening of calcium channels leading to Ca²⁺ influx

How does OR10J1 function differ from other olfactory receptors expressed in spermatozoa?

OR10J1 exhibits several distinguishing features compared to other olfactory receptors found in human spermatozoa:

FeatureOR10J1Other Spermatozoal ORs (e.g., OR1D2, OR7A5, OR4D1)
LocalizationPrimarily in midpiece and flagellumVarious (e.g., OR1D2 in midpiece)
LigandDimetolVarious (e.g., OR1D2: bourgeonal; OR7A5: myrac; OR4D1: 5α-androst-16-en-3-one)
Expression levelHigh and specific expressionVariable expression levels
Transcript typePrimarily sense transcriptsSome have both sense and antisense transcripts

The distinct localization pattern of OR10J1 suggests it may have specialized functions related to sperm motility or energetics, given its presence in the midpiece where mitochondria are concentrated. The different ligand specificities of various sperm ORs may allow spermatozoa to respond to a diverse array of chemical cues during their journey to the egg .

How can RNA-Seq data be analyzed to quantify OR10J1 expression in different tissues?

RNA-Seq analysis for quantifying OR10J1 expression requires a carefully designed bioinformatic pipeline:

  • Generation of high-quality RNA-Seq data from the tissues of interest, ensuring sufficient sequencing depth (typically >20 million reads per sample).

  • Quality control of raw reads (FastQC) followed by adapter trimming and filtering of low-quality reads.

  • Alignment of processed reads to the human reference genome (GRCh38/hg38) using splice-aware aligners such as STAR or HISAT2.

  • Quantification of OR10J1 expression using tools like featureCounts or RSEM, with results typically reported as FPKM (Fragments Per Kilobase of transcript per Million mapped reads) or TPM (Transcripts Per Million).

  • Comparative analysis of OR10J1 expression across different tissues, potentially using differential expression tools such as DESeq2 or edgeR.

  • Validation of RNA-Seq findings using orthogonal methods such as qRT-PCR.

In the case of OR10J1, RNA-Seq analysis has revealed specific expression in human spermatozoa and testis, with minimal to no expression in other reference tissues such as brain, colon, liver, lung, and skeletal muscle .

What challenges exist in detecting and quantifying OR10J1 transcripts?

Several technical challenges complicate the accurate detection and quantification of OR10J1 transcripts:

  • Sequence similarity with other ORs: The high sequence homology among olfactory receptor genes can lead to ambiguous read mapping, potentially confounding expression estimates.

  • Low expression levels: OR10J1, like many other ORs, may be expressed at relatively low levels, requiring deep sequencing coverage for reliable detection.

  • Alternative splicing and antisense transcription: While not specifically reported for OR10J1, many ORs exhibit complex transcriptional patterns including antisense transcripts that can complicate expression analysis.

  • Single-cell variability: OR expression may vary significantly between individual cells within a tissue, necessitating single-cell approaches for comprehensive characterization.

  • RNA quality from spermatozoa: Obtaining high-quality RNA from mature spermatozoa presents technical challenges due to their compact nuclear structure and reduced transcriptional activity.

Researchers should be aware of these challenges when designing experiments to study OR10J1 expression and consider employing complementary approaches such as in situ hybridization or single-cell RNA-Seq to address these limitations .

What is the evidence for OR10J1's role in sperm function?

Several lines of evidence support a functional role for OR10J1 in human sperm physiology:

  • Specific expression pattern: OR10J1 shows high and specific expression in human spermatozoa and testis, suggesting a specialized function in these tissues.

  • Subcellular localization: Immunocytochemical studies have localized OR10J1 protein to the midpiece of human spermatozoa, a region rich in mitochondria that provides energy for sperm motility.

  • Ligand identification: The identification of dimetol as a specific agonist for OR10J1 provides a tool for investigating its functional role.

  • Calcium signaling: Activation of OR10J1 by its ligand can trigger changes in intracellular calcium concentration, a key second messenger involved in various sperm functions including motility, capacitation, and the acrosome reaction.

Together, these findings suggest that OR10J1 may play a role in chemosensation during sperm migration, potentially responding to chemical cues in the female reproductive tract to regulate sperm behavior and function .

How does OR10J1 activation affect calcium signaling in spermatozoa?

The activation of OR10J1 by its ligand dimetol appears to modulate calcium signaling in human spermatozoa, though the complete signaling pathway remains to be fully characterized. The current understanding suggests:

  • Binding of dimetol to OR10J1 likely triggers a conformational change in the receptor, activating associated G-proteins.

  • This activation presumably leads to changes in second messenger levels (e.g., cAMP), ultimately resulting in calcium influx.

  • The increased intracellular calcium concentration can then regulate various aspects of sperm function, including motility patterns and progression through capacitation.

What controls are essential when studying OR10J1 activation?

When investigating OR10J1 activation and function, several critical controls should be included:

  • Mock-transfected controls: Cells transfected with empty vector should be tested alongside OR10J1-expressing cells to confirm that observed responses are receptor-specific.

  • Negative control ligands: Structurally related compounds that do not activate OR10J1 should be tested to confirm the specificity of the ligand-receptor interaction.

  • Positive control receptors: Well-characterized ORs (e.g., OR1D2) and their known ligands should be included as positive controls for the expression system and assay conditions.

  • Antibody specificity controls: When using antibodies to detect OR10J1, specificity controls should include:

    • Western blot validation

    • Peptide competition assays

    • Testing in tissues known to be negative for OR10J1

    • Testing with pre-immune serum

  • Calcium imaging controls: Ionomycin or other calcium ionophores should be used to verify cell viability and dye loading at the end of each experiment.

These controls are essential for ensuring the reliability and reproducibility of results in OR10J1 research .

What are the advantages and limitations of heterologous expression systems for studying OR10J1?

Heterologous expression systems, particularly the Hana3A cell line, offer several advantages for OR10J1 research but also come with important limitations:

Advantages:

  • Provide a controlled environment for studying receptor-ligand interactions

  • Allow for genetic manipulation and tagging of receptors

  • Enable high-throughput screening of potential ligands

  • Minimize confounding effects from other receptors or signaling pathways

  • Facilitate standardized protocols for comparative studies across different ORs

Limitations:

  • May not fully recapitulate the native cellular environment of spermatozoa

  • Often require addition of accessory factors (e.g., RTP1S, Ric8b) for efficient receptor trafficking

  • Cannot replicate the complex physiological context of sperm function

  • May exhibit different kinetics or sensitivity compared to native receptor expression

  • Potential for artifacts due to overexpression or fusion with tags

Researchers should be aware of these tradeoffs when designing experiments and interpreting results from heterologous expression systems, and should validate key findings in native tissues or physiologically relevant models when possible .

What are the most pressing unanswered questions about OR10J1 function?

Several critical questions remain unanswered regarding OR10J1 function:

  • What is the precise molecular mechanism by which OR10J1 activation leads to calcium signaling in spermatozoa?

  • Does OR10J1 interact with other receptors or signaling proteins to form functional complexes in sperm?

  • What is the physiological source of dimetol or similar compounds in the female reproductive tract?

  • How does OR10J1 activation translate into specific changes in sperm motility, capacitation, or fertilization capacity?

  • Do genetic variations in OR10J1 correlate with male fertility parameters in human populations?

  • What is the evolutionary significance of OR10J1 expression in sperm, and how conserved is this function across species?

Addressing these questions will require interdisciplinary approaches combining molecular biology, structural biology, reproductive physiology, and clinical studies .

What emerging technologies could advance OR10J1 research?

Several emerging technologies hold promise for advancing OR10J1 research:

  • CRISPR-Cas9 genome editing: Precise modification of OR10J1 in cellular models or animal models to study structure-function relationships and physiological roles.

  • Single-molecule imaging: Techniques such as single-molecule FRET or super-resolution microscopy to study OR10J1 dynamics and interactions in native membranes.

  • Cryo-electron microscopy: Structural determination of OR10J1 in complex with its ligand dimetol, providing insights into binding mechanisms.

  • Microfluidic sperm sorting: Development of microfluidic platforms incorporating dimetol gradients to assess OR10J1-mediated chemotactic responses.

  • Single-cell transcriptomics: Profiling of individual spermatozoa to understand heterogeneity in OR10J1 expression and its correlation with functional parameters.

  • Computational modeling: Molecular dynamics simulations and machine learning approaches to predict ligand binding and receptor activation mechanisms.

These technologies could provide unprecedented insights into OR10J1 function and its role in human reproduction, potentially opening new avenues for diagnostic or therapeutic applications in reproductive medicine .

How can researchers distinguish between specific OR10J1-mediated effects and non-specific responses in calcium imaging experiments?

Distinguishing specific OR10J1-mediated effects from non-specific responses requires several methodological considerations:

  • Concentration-response analysis: Perform dose-response experiments to establish the EC50 value for dimetol, which should be consistent with specific receptor activation (typically in the nanomolar to micromolar range).

  • Receptor knockdown/knockout controls: Use siRNA or CRISPR to reduce OR10J1 expression and demonstrate attenuation or loss of dimetol response.

  • Pharmacological inhibitors: Employ specific inhibitors of the putative OR10J1 signaling pathway (e.g., G-protein inhibitors) to confirm the mechanism of action.

  • Structure-activity relationship studies: Test structurally related analogs of dimetol to establish correlation between chemical structure and receptor activation.

  • Competitive binding assays: Demonstrate that non-activating ligands can compete with dimetol for binding to OR10J1.

  • Direct comparison with known CatSper activators: Compare response patterns with compounds known to directly activate CatSper channels, which may bypass receptor signaling.

These approaches can help researchers differentiate between specific OR10J1-mediated signaling and potential off-target effects or direct activation of downstream components .

What statistical approaches are recommended for analyzing OR10J1 experimental data?

For robust analysis of OR10J1 experimental data, the following statistical approaches are recommended:

  • For dose-response experiments:

    • Nonlinear regression analysis to determine EC50 values

    • Comparison of curve parameters using extra sum-of-squares F test

    • 95% confidence intervals for potency estimates

  • For calcium imaging data:

    • Normalization to baseline and positive control responses

    • Area under the curve (AUC) or peak amplitude measurements

    • Mixed-effects models to account for cell-to-cell variability

  • For expression quantification:

    • Log transformation of FPKM/TPM values to approximate normal distribution

    • DESeq2 or edgeR for differential expression analysis

    • Multiple testing correction (e.g., Benjamini-Hochberg procedure)

  • For comparing multiple experimental conditions:

    • ANOVA followed by appropriate post-hoc tests (e.g., Tukey's HSD)

    • Kruskal-Wallis test for non-parametric data

    • Clear reporting of sample sizes, effect sizes, and exact p-values

  • For reproducibility assessment:

    • Intraclass correlation coefficients for technical replicates

    • Meta-analysis approaches for combining data across experiments

    • Power analysis for determining appropriate sample sizes

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.