Recombinant Human Olfactory receptor 10J5 (OR10J5)

Shipped with Ice Packs
In Stock

Description

Functional Roles

OR10J5 is ectopically expressed in non-olfactory tissues, where it regulates critical processes:

Angiogenesis

  • Mechanism: Activation by the floral odorant Lyral induces Ca²⁺ influx and AKT phosphorylation in endothelial cells (HUVECs), promoting migration and angiogenesis .

  • In Vivo Impact: Lyral enhances blood vessel formation in Matrigel plug assays .

Metabolic Regulation

  • Hepatocyte Lipid Accumulation: Modulates lipid metabolism via the cAMP-PKA pathway, reducing triglyceride synthesis .

Cardiovascular System

  • Localization: Expressed in the aorta, coronary arteries, and endothelial cells .

  • Pathway: OR10J5 signaling impacts cardiac function through Ca²⁺-dependent AKT activation .

Ligand Interactions

OR10J5 is narrowly tuned, responding to specific odorants:

LigandEffectSignaling PathwayReference
Lyral (floral aldehyde)Activates receptor, induces Ca²⁺/AKT signalingGβγ → PLC → IP₃ → Ca²⁺ → AKT
α-Cedrene (sesquiterpene)Binds OR10J5, enhances receptor activitycAMP-PKA

Research Applications

Recombinant OR10J5 is critical for:

  • Drug Discovery: Screening for allosteric modulators (e.g., octanal, heliopropanal) that enhance Lyral-induced receptor activation .

  • Disease Models: Studying roles in atherosclerosis (via endothelial dysfunction) and metabolic disorders .

Key Research Findings

  • Cardiovascular Angiogenesis: OR10J5 knockdown inhibits Lyral-induced endothelial migration by ~60% .

  • Metabolic Impact: Activation reduces hepatic GPAM expression, lowering triglyceride synthesis .

  • Ligand Specificity: OR10J5 exhibits higher affinity for aldehydes (e.g., Lyral) than ketones or alcohols .

Unresolved Questions

  • Endogenous Ligands: Unknown beyond synthetic odorants like Lyral .

  • Tissue-Specific Signaling: How OR10J5 interacts with local GPCR networks in non-olfactory tissues .

This synthesis integrates structural, functional, and pharmacological data to highlight OR10J5’s emerging roles in vascular biology and metabolism. Further studies are needed to explore its therapeutic potential in cardiovascular and metabolic diseases.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate your preference when placing the order, and we will accommodate your request.
Lead Time
Delivery time may vary based on the purchase method or location. Please consult your local distributors for specific delivery timeframes.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please contact us in advance, as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. For short-term storage, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer composition, storage temperature, and the protein's intrinsic stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize the development of the specified tag.
Synonyms
OR10J5; Olfactory receptor 10J5; Olfactory receptor OR1-28
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-309
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
OR10J5
Target Protein Sequence
MKRKNFTEVSEFIFLGFSSFGKHQITLFVVFLTVYILTLVANIIIVTIICIDHHLHTPMY FFLSMLASSETVYTLVIVPRMLLSLIFHNQPISLAGCATQMFFFVILATNNCFLLTAMGY DRYVAICRPLRYTVIMSKGLCAQLVCGSFGIGLTMAVLHVTAMFNLPFCGTVVDHFFCDI YPVMKLSCIDTTINEIINYGVSSFVIFVPIGLIFISYVLVISSILQIASAEGRKKTFATC VSHLTVVIVHCGCASIAYLKPKSESSIEKDLVLSVTYTIITPLLNPVVYSLRNKEVKDAL CRVVGRNIS
Uniprot No.

Target Background

Function
Odorant receptor.
Gene References Into Functions
  1. Research data demonstrate the physiological role of OR10J5 in angiogenesis and highlights the involvement of olfactory receptors in HUVEC cells. PMID: 25791473
Database Links

HGNC: 14993

KEGG: hsa:127385

STRING: 9606.ENSP00000334441

UniGene: Hs.553587

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is OR10J5 and where is it expressed beyond the olfactory epithelium?

OR10J5 is a G-protein-coupled receptor belonging to the olfactory receptor family. While traditionally associated with olfactory sensory neurons, OR10J5 demonstrates significant ectopic expression in multiple tissues. It has been conclusively identified in the human aorta, coronary artery, umbilical vein endothelial cells (HUVEC) , and hepatocytes . Expression mapping has also suggested presence in other non-chemosensory tissues according to transcriptomic analyses . This ectopic expression pattern suggests broader physiological roles beyond olfactory perception, making it an intriguing target for diverse research applications in cardiovascular biology, metabolism, and other fields.

What are the confirmed ligands for OR10J5?

Current research has identified two principal ligands for OR10J5. The first is lyral, a synthetic floral odorant that has been shown to activate OR10J5 and induce calcium signaling and AKT phosphorylation in HUVEC cells . The second confirmed ligand is α-cedrene, a natural sesquiterpene constituent of cedarwood oil derived from Cupressus and Juniperus species . Both compounds bind to OR10J5 with sufficient specificity to trigger downstream signaling cascades. When designing experiments involving OR10J5 activation, researchers should consider using these validated ligands at concentrations established in previous studies to ensure reliable receptor activation and downstream pathway engagement.

What is the basic structure of OR10J5 and how does it bind to ligands?

OR10J5, like other olfactory receptors, has a 7-transmembrane domain structure characteristic of G-protein-coupled receptors . Computational binding studies have revealed that the interaction between lyral and OR10J5 specifically involves five amino acid residues: Phe104, Val105, Cyx178, Ile180, and Tyr258 . These residues are strategically located within the receptor structure: two on transmembrane domain 3 (TM3), two on extracellular loop 2 (EL2), and one on transmembrane domain 6 (TM6) . Understanding this binding profile is essential for researchers designing experiments involving site-directed mutagenesis, protein engineering, or pharmacological manipulation of OR10J5 function.

What methods are most effective for studying OR10J5 expression in tissue samples?

Multiple complementary techniques have proven effective for detecting OR10J5 expression. For initial screening, reverse transcription polymerase chain reaction (RT-PCR) provides sensitive detection of OR10J5 mRNA in various tissues . For protein-level confirmation, Western blotting with validated antibodies against OR10J5 is recommended . Immunohistochemistry or immunofluorescence assays provide valuable spatial information about receptor localization within tissues. For comprehensive expression analysis, RNA sequencing approaches have revealed detailed expression patterns across multiple tissues . Researchers should employ at least two independent methods to confirm expression, ideally combining nucleic acid-based detection with protein verification to avoid artifacts associated with single-method approaches.

How can researchers effectively conduct knockdown studies to investigate OR10J5 function?

RNA interference (RNAi) has been successfully used to interrogate OR10J5 function in multiple cell types. In HUVEC cells, OR10J5 knockdown inhibited lyral-induced calcium signaling and AKT phosphorylation, confirming the receptor's role in these processes . In hepatocytes, siRNA-mediated knockdown of OR10J5 increased intracellular lipid accumulation, altered expression of lipogenic genes, and downregulated fatty acid oxidation genes . When designing knockdown experiments, researchers should include appropriate controls (scrambled siRNA sequences), validate knockdown efficiency by qPCR and Western blot, and examine multiple downstream effects to comprehensively characterize OR10J5 function. Parallel experiments with known OR10J5 ligands can further validate the specificity of observed knockdown effects.

What functional assays are most informative for studying OR10J5 activity?

Several functional assays have proven valuable for investigating OR10J5 activity across different experimental systems. Calcium flux assays measuring intracellular Ca²⁺ levels following ligand stimulation effectively demonstrate OR10J5 activation . Phosphorylation assays for AKT can detect downstream signaling events after receptor activation . For HUVEC studies, migration assays and Matrigel plug assays have successfully measured the angiogenic effects of OR10J5 activation . In hepatocytes, lipid accumulation assays combined with gene expression analysis of metabolic markers effectively quantify OR10J5's impact on lipid metabolism . Researchers should select assays that align with the specific physiological process under investigation while maintaining appropriate controls for ligand specificity and receptor dependency.

How does OR10J5 activation influence calcium signaling and what methodologies best capture this relationship?

OR10J5 activation by ligands such as lyral induces calcium (Ca²⁺) flux in responsive cells including HUVEC . This calcium signaling appears to be a critical early event in the signal transduction cascade. For experimental investigation, researchers should consider employing calcium-sensitive fluorescent dyes (e.g., Fura-2 AM) combined with real-time imaging to capture dynamic calcium responses. Calcium chelators can be used as controls to confirm the calcium dependency of downstream effects. Patch-clamp electrophysiology provides more detailed insights into the ionic mechanisms involved. Importantly, knockdown studies have confirmed that lyral-induced calcium signaling is mediated specifically by OR10J5, as RNAi targeting the receptor inhibits this response , suggesting a direct mechanistic link between receptor activation and calcium mobilization.

What is the relationship between OR10J5 activation and AKT signaling pathways?

OR10J5 activation leads to phosphorylation of AKT, a crucial signaling molecule involved in cellular growth, survival, and metabolism . In HUVEC cells, lyral stimulation of OR10J5 activates a Ca²⁺-dependent AKT signal transduction pathway that regulates angiogenesis and cellular migration . This relationship has been confirmed through knockdown studies showing that OR10J5 silencing inhibits lyral-induced AKT phosphorylation . For researchers investigating this pathway, Western blot analysis with phospho-specific antibodies against AKT, combined with upstream inhibitors of calcium signaling and downstream AKT inhibitors, can help delineate the specific components of this signaling cascade. Time-course experiments are particularly valuable for establishing the temporal dynamics of OR10J5-mediated AKT activation.

How does OR10J5 interact with the cAMP-PKA pathway in hepatocytes?

In hepatocytes, OR10J5 activation by α-cedrene engages the cAMP-PKA (cyclic adenosine monophosphate-protein kinase A) pathway to regulate lipid metabolism . This signaling mechanism differs from the calcium-AKT pathway observed in endothelial cells, highlighting the context-dependent nature of OR10J5 signaling. When investigating this pathway, researchers should measure intracellular cAMP levels using ELISA or FRET-based biosensors following ligand stimulation. PKA activity assays can confirm downstream activation. Pharmacological inhibitors of adenylyl cyclase (which produces cAMP) or PKA can help validate pathway specificity. Gene expression analysis of PKA-responsive genes provides further evidence of pathway engagement. This comprehensive approach can establish the mechanistic link between OR10J5 activation and metabolic reprogramming in hepatocytes.

What is the role of OR10J5 in angiogenesis and how can this be studied experimentally?

OR10J5 has been identified as a key regulator of angiogenesis, with its activation by lyral enhancing migration of human umbilical vein endothelial cells (HUVEC) . In vivo evidence from Matrigel plug assays has confirmed that lyral stimulation enhances angiogenesis through OR10J5-mediated mechanisms . To investigate this function, researchers should employ a combination of in vitro and in vivo techniques. Cell migration assays (wound healing, Boyden chamber) can quantify the migratory response of endothelial cells following OR10J5 activation. Tube formation assays assess the capacity of endothelial cells to form vessel-like structures on extracellular matrix substrates. For in vivo validation, Matrigel plug assays provide a well-established method to quantify functional angiogenesis. Receptor specificity should be confirmed through knockdown/knockout approaches or competitive antagonists when available.

How does OR10J5 regulate lipid metabolism in hepatocytes?

OR10J5 plays a crucial role in regulating lipid accumulation in human hepatocytes . RNA interference-mediated knockdown of OR10J5 increases intracellular lipid accumulation, upregulates lipogenic genes, and downregulates genes related to fatty acid oxidation . Conversely, stimulation with the OR10J5 agonist α-cedrene significantly reduces lipid content in hepatocytes and reprograms metabolic gene expression profiles . These effects appear to be mediated through the OR10J5-cAMP-PKA pathway . For experimental investigation, researchers should quantify intracellular lipid accumulation using Oil Red O staining or BODIPY labeling, measure expression of key metabolic genes (SREBP-1c, FAS, CPT1) by qPCR, and assess fatty acid oxidation rates using radiolabeled substrates or oxygen consumption measurements. Combined with receptor manipulation approaches, these methods can provide comprehensive insights into OR10J5's metabolic functions.

What evidence supports OR10J5's role in dermatological conditions like contact dermatitis?

Computational binding studies have established a structural relationship between lyral, a known allergen that produces contact dermatitis, and its binding to OR10J5 . The binding interaction involves specific amino acid residues (Phe104, Val105, Cyx178, Ile180, and Tyr258) within the OR10J5 structure . While this suggests a potential role for OR10J5 in mediating dermatological responses to certain allergens, further functional validation is needed. Researchers investigating this connection should consider patch testing with lyral in conjunction with OR10J5 expression analysis in skin samples, immunohistochemical localization of OR10J5 in different skin layers, and ex vivo skin models to evaluate inflammatory marker expression following lyral exposure. Animal models with tissue-specific OR10J5 manipulation could provide additional insights into the receptor's role in allergic dermatitis.

What are the critical considerations for heterologous expression of OR10J5 in experimental systems?

Heterologous expression of OR10J5 presents significant challenges due to the poor trafficking of olfactory receptors to the plasma membrane in non-native cell types. Successful surface expression has been achieved using specialized expression systems such as Hana3A cells . When establishing an OR10J5 expression system, researchers should incorporate N-terminal epitope tags (such as FLAG or Rho tags) to facilitate detection while avoiding interference with ligand binding. Surface expression should be verified through multiple complementary techniques including Western blotting of surface proteins, confocal microscopy, and flow cytometry . Based on published methodologies, approximately 50% surface expression efficiency can be achieved in optimized systems . Controlling for expression levels and ensuring proper membrane localization are critical for obtaining physiologically relevant results in functional studies.

How can researchers resolve contradictions between OR10J5 signaling pathways in different tissues?

OR10J5 activation triggers distinct signaling pathways in different cellular contexts: a Ca²⁺-dependent AKT pathway in endothelial cells versus a cAMP-PKA pathway in hepatocytes . These differences likely reflect tissue-specific expression of G-protein subunits, accessory proteins, or downstream effectors. To resolve these contradictions, researchers should conduct comprehensive G-protein coupling assays using techniques such as BRET (bioluminescence resonance energy transfer) or FRET to determine which G-protein subtypes interact with OR10J5 in each cell type. Comparative transcriptomics or proteomics of different OR10J5-expressing tissues can identify cell-specific cofactors that might direct signaling specificity. Additionally, simultaneous measurement of multiple second messengers (Ca²⁺, cAMP, IP₃) following OR10J5 activation in different cell types can establish the primary signaling modality in each context.

What approaches should be used to investigate potential physiological ligands for OR10J5 beyond currently known agonists?

While lyral and α-cedrene are confirmed OR10J5 agonists , the natural physiological ligands in different tissues remain largely speculative. To identify novel ligands, researchers should implement a multi-faceted discovery approach. Computational screening based on the known binding structure with lyral can identify candidates with similar chemical features. High-throughput screening using cell-based reporter assays (measuring calcium, cAMP, or other second messengers) can efficiently test large compound libraries. Metabolomic profiling of tissues where OR10J5 is expressed may reveal endogenous molecules capable of receptor activation. Validation of candidate ligands should include dose-response analyses, competitive binding assays against known ligands, and confirmation of specificity through receptor knockdown experiments. This comprehensive approach may uncover tissue-specific endogenous ligands that explain the diverse physiological roles of OR10J5.

What potential exists for targeting OR10J5 in metabolic disorders such as hepatic steatosis?

OR10J5 activation by α-cedrene significantly reduces lipid content in human hepatocytes and reprograms metabolic gene expression through the cAMP-PKA pathway . This suggests therapeutic potential for OR10J5 agonists in treating hepatic steatosis. Researchers exploring this application should conduct preclinical studies using both cell culture models of steatosis (e.g., free fatty acid-loaded hepatocytes) and animal models of non-alcoholic fatty liver disease. Key endpoints should include quantitative assessment of hepatic triglyceride content, histological evaluation of lipid droplets, comprehensive metabolic profiling, and analysis of inflammatory markers. Long-term studies are necessary to evaluate the sustainability of metabolic improvements and potential compensatory mechanisms. Additionally, tissue-specific delivery strategies should be developed to target hepatic OR10J5 while minimizing off-target effects in other OR10J5-expressing tissues.

How might the angiogenic properties of OR10J5 be leveraged in regenerative medicine?

The established role of OR10J5 in promoting endothelial cell migration and angiogenesis presents opportunities for applications in wound healing, tissue engineering, and ischemic disease treatment. Researchers investigating these applications should develop controlled-release systems for OR10J5 agonists like lyral, potentially incorporating them into biomaterials or tissue scaffolds. Efficacy should be evaluated in models of impaired wound healing or tissue ischemia, with quantitative assessment of vascular density, tissue perfusion, and functional recovery. Potential synergistic effects with established pro-angiogenic factors (VEGF, FGF) warrant investigation through combination studies. Safety assessments must carefully evaluate the risk of pathological angiogenesis or tumor vascularization. As translational development progresses, pharmacokinetic/pharmacodynamic modeling will be essential for optimizing dosing regimens and delivery strategies.

What are the technical challenges and potential solutions for developing specific OR10J5 modulators for research applications?

Developing highly specific modulators (agonists or antagonists) for OR10J5 presents significant challenges due to the structural similarity among olfactory receptors. Structure-based drug design approaches, informed by the known binding interactions of lyral and α-cedrene , offer promising pathways for developing selective compounds. Researchers should establish reliable high-throughput screening systems using OR10J5-expressing cell lines with appropriate reporter assays. Counter-screening against closely related olfactory receptors is essential to confirm specificity. Medicinal chemistry optimization should focus on enhancing selectivity while maintaining favorable pharmacokinetic properties. For research applications, the development of tool compounds with orthogonal chemical structures but similar functional effects can help validate the specificity of observed biological responses. Additionally, photoaffinity labeling probes or fluorescent ligands could provide valuable tools for visualizing receptor localization and trafficking dynamics in living cells.

Table 1: Key Experimental Systems for Studying OR10J5 Functions

Experimental SystemApplicationsKey AssaysAdvantagesLimitations
HUVECAngiogenesis, Cell migrationCa²⁺ flux, AKT phosphorylation, Migration assay, Matrigel plug assayPhysiologically relevant, Well-established protocolsVariable donor characteristics
Human HepatocytesLipid metabolismLipid accumulation, Gene expression, cAMP measurementDirect translational relevanceLimited availability, Short lifespan
Hana3A CellsLigand screening, Structure-function studiesSurface expression, Reporter assaysHigh OR expression efficiency, Established systemArtificial expression system
In vivo modelsPhysiological functionAngiogenesis, Metabolic functionSystemic context, Disease modelsSpecies differences in OR function
Computational modelsBinding prediction, Drug designMolecular docking, MD simulationRapid screening, Mechanistic insightsRequires experimental validation

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.