Recombinant Human Olfactory receptor 10Q1 (OR10Q1)

Shipped with Ice Packs
In Stock

Description

Molecular Structure and Characteristics

OR10Q1 is a transmembrane protein with a 7-transmembrane domain (7TM) structure, typical of GPCRs. Its amino acid sequence includes hydrophobic regions that form the transmembrane helices (TM1-TM7) and extracellular/intracellular loops (ECL1-3, ICL1-3). Key structural features include:

FeatureDetails
Gene OriginChromosome 11 (human)
Transmembrane DomainsTM1-TM7 (positions: TM1: 10–30, TM2: 60–70, etc.)
Fusion TagsN-terminal His6ABP or GST tags for purification
Molecular WeightPredicted: ~35 kDa (varies due to post-translational modifications)

Production and Purification Methods

Recombinant OR10Q1 is produced in heterologous systems, with two primary approaches documented:

Table 1: Production Systems and Purification

SystemDetailsPurification MethodYield
E. coliN-terminal His6ABP fusion tag; expressed in inclusion bodies IMAC chromatography>0.5 mg/ml concentration
Wheat GermGST fusion tag; in vitro expression preserves folding Gel filtration, IMACNot specified

Post-expression, OR10Q1 is solubilized using detergents and purified via affinity chromatography. For functional studies, dimerization has been observed in similar olfactory receptors (e.g., hOR1A1), though monomeric forms dominate .

Applications in Research

Recombinant OR10Q1 serves as a tool for studying receptor-ligand interactions and structural biology:

Key Applications

  1. Antigen for Antibody Assays

    • Used as a blocking antigen in antibody competition assays to validate specificity .

    • Example: NBP2-13692PEP (Bio-Techne) is optimized for epitope mapping.

  2. Structural Studies

    • Purified OR10Q1 is analyzed via circular dichroism (CD) to confirm proper folding .

    • Size-exclusion chromatography (SEC-MALS) reveals monomeric and dimeric forms .

  3. Ligand Binding Assays

    • Recombinant OR10Q1 is tested for odorant binding using intrinsic tryptophan fluorescence .

    • Note: No physiological ligands are reported for OR10Q1; studies focus on deorphanization efforts .

Functional Insights

  • Ligand Binding: Similar olfactory receptors (e.g., hOR1A1) bind micromolar-range odorants . OR10Q1’s ligands remain unidentified due to limited functional studies .

  • Dimerization: Purified receptors may form dimers, though monomers are more prevalent in solution .

  • Mutagenesis Studies: Site-directed mutagenesis of OR10Q1 has been performed to study receptor-odorant interactions, though specific results are not publicly disclosed .

Challenges

  • Low Expression: OR10Q1 is challenging to express in heterologous systems, requiring auxiliary proteins (e.g., RTP1, REEP1) for trafficking .

  • Stability: Freeze-thaw cycles reduce activity; storage at -20°C or -80°C is recommended .

Functional Roles and Speculation

While OR10Q1 is primarily studied for odor detection, its broader roles remain speculative:

  • Non-Olfactory Functions: Other olfactory receptors (e.g., OR51E1) modulate cardiac function and immune responses . OR10Q1 may have analogous roles, but no direct evidence exists.

  • Cancer Research: Olfactory receptors like OR2AT4 are implicated in leukemia treatment . OR10Q1’s potential in oncology is unexplored.

  1. High-Throughput Screening: Identifying ligands for OR10Q1 using odorant libraries.

  2. Structural Biology: Solving the crystal or NMR structure to guide drug design.

  3. Therapeutic Potential: Exploring roles in non-olfactory systems (e.g., cardiovascular, immune).

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format readily available in our inventory. However, should you have specific format requirements, please indicate them during order placement, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Kindly consult your local distributors for specific delivery timelines.
Note: Our proteins are standardly shipped with regular blue ice packs. If dry ice shipping is preferred, please communicate with us beforehand, as additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. For optimal usage, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by multiple factors, including storage conditions, buffer composition, storage temperature, and the inherent stability of the protein.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specified tag type, please inform us, and we will prioritize developing it accordingly.
Synonyms
OR10Q1; Olfactory receptor 10Q1; Olfactory receptor OR11-233
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-319
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
OR10Q1
Target Protein Sequence
MPVGKLVFNQSEPTEFVFRAFTTATEFQVLLFLLFLLLYLMILCGNTAIIWVVCTHSTLR TPMYFFLSNLSFLELCYTTVVVPLMLSNILGAQKPISLAGCGAQMFFFVTLGSTDCFLLA IMAYDRYVAICHPLHYTLIMTRELCTQMLGGALGLALFPSLQLTALIFTLPFCGHHQEIN HFLCDVPPVLRLACADIRVHQAVLYVVSILVLTIPFLLICVSYVFITCAILSIRSAEGRR RAFSTCSFHLTVVLLQYGCCSLVYLRPRSSTSEDEDSQIALVYTFVTPLLNPLLYSLRNK DVKGALRSAIIRKAASDAN
Uniprot No.

Target Background

Function
Odorant receptor.
Database Links

HGNC: 15134

KEGG: hsa:219960

STRING: 9606.ENSP00000314324

UniGene: Hs.553646

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Recombinant Human Olfactory receptor 10Q1 (OR10Q1) and what characterizes its molecular structure?

Recombinant Human Olfactory receptor 10Q1 (OR10Q1) is a member of the olfactory receptor family involved in the biological process of sensory perception of smell. It belongs to the G-protein coupled receptor 1 family, functioning as an odorant receptor that transduces olfactory signals from the environment . Based on structural characteristics of similar olfactory receptors, OR10Q1 likely contains transmembrane domains typical of G-protein coupled receptors, with specific binding regions that interact with odorant molecules .

The recombinant form of this protein is typically expressed in heterologous systems for experimental purposes. Considering similar olfactory receptors, full-length OR10Q1 may consist of approximately 300-310 amino acids, though exact characterization requires protein-specific analysis .

How does OR10Q1 function within the broader context of olfactory perception?

OR10Q1 functions as a chemosensor that detects odorant molecules in the nasal epithelium and initiates the signaling cascade that ultimately leads to odor perception. When an odorant binds to OR10Q1, it triggers a conformational change in the receptor, activating the associated G-protein (typically Gαolf, encoded by GNAL gene) which stimulates adenylyl cyclase, increasing cAMP levels and opening cyclic nucleotide-gated channels .

OR10Q1 is specifically categorized under the GO term "GO:0007608~sensory perception of smell" alongside other olfactory receptors including OR10A5, OR52H1, and OR51B2, indicating its direct involvement in olfactory cognition pathways . The receptor exhibits remarkable selectivity for specific odorant molecules, contributing to the complex process of odor discrimination.

What is the significance of genetic diversity in OR10Q1 and how does it compare to other olfactory receptor genes?

Olfactory receptor genes, including OR10Q1, demonstrate extraordinary genetic diversity in human populations. This diversity is reflected in both their coding regions and regulatory elements. According to findings from the 1000 Genomes Project, genes in the olfactory transduction pathway exhibit the highest SNP content in coding regions (16.9 SNPs per 1000 bp) among all examined KEGG pathways .

OR10Q1 appears among genes with elevated SNP content in upstream regions, suggesting potentially significant regulatory variation affecting its expression . This genetic diversity likely contributes to individualized odor perception capabilities, as variations in receptor structure and expression levels can alter sensitivity to specific odorants. The evolutionary significance of this diversity may reflect the importance of olfactory discrimination across different environmental contexts and food sources throughout human evolution.

How do SNPs in the promoter region of OR10Q1 affect its expression patterns?

SNPs in the promoter region of OR10Q1 can substantially impact its transcriptional regulation and subsequent expression patterns. Research indicates that olfactory receptor genes, including OR10Q1, contain an unusually high density of SNPs in their upstream regulatory regions . These promoter-region polymorphisms can affect transcription factor binding efficiency, RNA polymerase recruitment, and chromatin accessibility.

Studies focusing on olfactory receptor genes reveal that "the extremely high SNP content in the promoters of OR genes...causes variations in gene expression. In turn, the elevated variability in ORs expression may partly explain individual differences in odor perception" . For OR10Q1 specifically, variations in its promoter region may modulate the receptor's expression levels in subsets of olfactory sensory neurons, potentially affecting detection thresholds for specific odorants recognized by this receptor.

What expression systems are recommended for producing functional recombinant OR10Q1?

For functional expression of OR10Q1, researchers should consider several established systems with demonstrated success for olfactory receptors:

  • Wheat germ cell-free system: This cell-free translation system has been successfully used for other olfactory receptors, providing a viable approach for OR10Q1 expression with proper folding and avoiding potential toxicity issues faced in cellular systems .

  • Mammalian expression systems: HEK293 cells with specific modifications to enhance GPCR expression (such as G-protein overexpression) may improve functional yields of OR10Q1.

  • Insect cell systems: Sf9 or Hi5 cells with baculovirus vectors provide another alternative that has shown success with challenging membrane proteins.

Each system requires optimization of expression conditions, including temperature, induction parameters, and addition of stabilizing agents. Post-expression validation using techniques such as Western blotting and functional assays is essential to confirm proper folding and activity of the recombinant OR10Q1 .

What methodological approaches should be employed for characterizing OR10Q1-ligand interactions?

Characterization of OR10Q1-ligand interactions requires a systematic multi-technique approach:

  • Calcium imaging assays: Transfect cells expressing OR10Q1 with a calcium-sensitive fluorescent reporter to measure intracellular calcium flux upon receptor activation by potential ligands.

  • cAMP accumulation assays: Measure changes in cAMP levels using ELISA or FRET-based sensors to detect OR10Q1 activation.

  • Bioluminescence resonance energy transfer (BRET): Monitor conformational changes in the receptor upon ligand binding by tagging OR10Q1 and associated proteins with appropriate donor/acceptor pairs.

  • Competitive binding assays: Use radiolabeled or fluorescently labeled known ligands to perform displacement studies with potential new ligands.

  • Surface plasmon resonance (SPR): Characterize binding kinetics of purified receptor with potential ligands using real-time interaction analysis.

These methods should be complemented with dose-response analyses to determine EC50 values for identified ligands, allowing quantitative comparison of binding affinities and signaling efficacies.

How should researchers address the high genetic variability of OR10Q1 when designing experiments?

The high genetic variability of OR10Q1 presents significant challenges that researchers should address through careful experimental design:

  • Reference sequence selection: Clearly define which OR10Q1 variant serves as the reference for your study. Consider using the canonical sequence from curated databases while acknowledging potential population variations.

  • Haplotype analysis: Rather than studying isolated SNPs, consider analyzing common haplotypes of OR10Q1 that may have co-evolved functional significance.

  • Population stratification: Include samples from diverse ethnic backgrounds to account for population-specific variations in OR10Q1. The 1000 Genomes Project data reveals significant variability in olfactory receptor genes across populations .

  • Common variant controls: Include common OR10Q1 variants as experimental controls to establish a baseline for functional comparisons.

  • Targeted sequencing: Implement deep sequencing of the OR10Q1 locus in study participants to identify all relevant variants before functional analysis.

Approach to Genetic VariabilityImplementation StrategyAdvantagesLimitations
Reference sequence standardizationUse consensus sequence from population databasesProvides consistent comparison pointMay not represent functional variants
Haplotype-based analysisAnalyze co-occurring SNPs as functional unitsCaptures epistatic interactionsRequires larger sample sizes
Cross-population samplingInclude diverse ethnic backgroundsImproves generalizability of findingsIncreases complexity of analysis
Functional variant screeningTest multiple variants for functional differencesDirectly links genotype to phenotypeResource intensive

What statistical approaches are recommended for analyzing OR10Q1 SNP-phenotype associations?

Given the complex genetic landscape of olfactory receptors, statistical analysis of OR10Q1 SNP-phenotype associations requires specialized approaches:

  • Gene-based association tests: Instead of single-marker tests, use methods that aggregate effects across the OR10Q1 locus (e.g., SKAT, burden tests) to capture cumulative impact of multiple variants.

  • Haplotype regression models: Implement haplotype-based regression approaches that consider combinations of variants rather than individual SNPs.

  • Machine learning classification: Apply supervised learning algorithms to identify patterns in how multiple OR10Q1 variants collectively influence phenotypes.

  • Bayesian network analysis: Model complex relationships between genetic variants, expression levels, and phenotypic outcomes using probabilistic graphical models.

  • Mediation analysis: Assess whether the effect of OR10Q1 variants on phenotypes is mediated through changes in expression levels or protein function.

For all analyses, researchers should implement rigorous multiple testing correction procedures to account for the high density of SNPs in olfactory receptor genes (as evidenced by the study showing olfactory receptors have "the highest SNP content in coding regions (16.9 SNPs per 1000 bp) among examined KEGG pathways") .

What functional assays are most appropriate for validating OR10Q1 activity in vitro?

Validating OR10Q1 activity requires a battery of complementary functional assays:

  • Luciferase reporter assays: Construct systems where OR10Q1 activation triggers luciferase expression via cAMP response elements, providing quantifiable readout of receptor functionality.

  • Electrophysiological measurements: Implement patch-clamp techniques in cells expressing OR10Q1 along with appropriate ion channels to measure electrical responses to odorant exposure.

  • GTP-binding assays: Quantify G-protein activation using non-hydrolyzable GTP analogs to confirm signal transduction capability of expressed OR10Q1.

  • ELISA and Western blotting: Verify expression and proper folding of the recombinant OR10Q1 protein using techniques applicable to membrane proteins .

  • Fluorescence microscopy: Confirm appropriate cellular localization of OR10Q1 using fluorescently tagged constructs or immunostaining.

Each assay should include appropriate positive controls (known functional olfactory receptors) and negative controls (non-functional receptor mutants) to establish assay validity. Additionally, researchers should implement dose-response protocols to characterize the sensitivity and dynamic range of OR10Q1 responses to potential ligands.

How can researchers effectively identify potential ligands for OR10Q1?

Identifying OR10Q1 ligands requires a systematic deorphanization strategy:

  • Computational screening: Employ molecular docking simulations using homology models of OR10Q1 to predict potential ligands from odorant libraries.

  • High-throughput screening: Test chemical libraries containing diverse odorants using cell-based assays that measure OR10Q1 activation through calcium imaging or cAMP detection.

  • Cheminformatic approaches: Apply similarity-based virtual screening to identify compounds structurally related to known ligands of phylogenetically similar olfactory receptors.

  • Fragment-based screening: Test molecular fragments and structural scaffolds to identify binding motifs recognized by OR10Q1.

  • Reverse engineering from psychophysical data: Correlate human perception data with genetic variations in OR10Q1 to hypothesize potential ligands based on perceptual differences between individuals with different OR10Q1 variants.

The integration of these approaches, along with validation experiments using increasingly stringent criteria, provides the most effective strategy for identifying specific OR10Q1 ligands. Given the documented high genetic diversity of olfactory receptors , researchers should consider testing multiple variants of OR10Q1 to account for potential functional differences in ligand specificity.

How might OR10Q1 research contribute to understanding the genetic basis of olfactory perception?

OR10Q1 research offers valuable insights into the genetic basis of olfactory perception through several avenues:

  • Personalized odor coding: By studying how genetic variations in OR10Q1 affect odor perception, researchers can better understand mechanisms underlying individual differences in smell sensitivity and preference. OR10Q1 is among genes identified in studies examining "extremely high level of DNA sequence variation" in olfactory cognition .

  • Receptor-ligand specificity determinants: Structure-function analysis of OR10Q1 variants can reveal critical amino acid residues that determine odorant specificity, advancing our understanding of the molecular basis of odor discrimination.

  • Regulatory networks: Investigating the transcriptional regulation of OR10Q1 provides insights into the "one-receptor-one-neuron" rule governing olfactory system development and the mechanisms ensuring singular expression of olfactory receptors.

  • Evolutionary perspectives: Comparative genomic analysis of OR10Q1 across species can illuminate the evolutionary forces shaping human olfactory perception capabilities and adaptation to different ecological niches.

  • Gene-environment interactions: Research into how environmental factors influence OR10Q1 expression contributes to our understanding of acquired changes in olfactory sensitivity throughout life.

The study finding that "the extremely high SNP content in the promoters of OR genes...causes variations in gene expression" which "may partly explain individual differences in odor perception" highlights the importance of studying regulatory variations in OR10Q1 and similar genes .

What potential applications exist for OR10Q1 in biosensor development?

OR10Q1 holds substantial potential for integration into biosensor platforms:

  • Electronic nose technology: Incorporation of OR10Q1 into cell-based or cell-free biosensors could enable detection of specific odorant molecules with high sensitivity and selectivity, useful for environmental monitoring, food safety testing, or medical diagnostics.

  • Disease biomarker detection: If OR10Q1 responds to compounds associated with specific disease states, biosensors incorporating this receptor could serve as diagnostic tools for detecting volatile biomarkers in patient samples.

  • Quality control applications: OR10Q1-based sensors might detect specific compounds indicating spoilage or contamination in food products or pharmaceuticals.

  • Security applications: Sensors utilizing OR10Q1 might detect trace amounts of specific compounds relevant to security screening.

  • Personalized consumer products: Knowledge of OR10Q1 function could inform development of personalized fragrances or flavors optimized for individuals with specific receptor variants.

The development of "Human Olfactory Receptor Sensor for Odor Reconstitution" technologies suggests the feasibility of such applications . Implementation would require stable expression systems and signal transduction mechanisms optimized for OR10Q1's specific properties.

What emerging technologies might advance OR10Q1 research?

Several cutting-edge technologies promise to revolutionize OR10Q1 research:

  • Cryo-EM structural analysis: As cryo-electron microscopy techniques improve for membrane proteins, determination of OR10Q1's precise structure becomes increasingly feasible, potentially revealing critical insights into its ligand binding mechanisms.

  • Single-cell transcriptomics: Application of single-cell RNA sequencing to olfactory sensory neurons expressing OR10Q1 can reveal co-expression patterns and regulatory networks controlling receptor expression.

  • Advanced organoid models: Development of human olfactory epithelium organoids expressing OR10Q1 variants provides physiologically relevant systems for studying receptor function in a native-like context.

  • Nanobody development: Engineering of nanobodies specific to OR10Q1 could facilitate purification, crystallization, and functional studies of this challenging membrane protein.

  • Spatial transcriptomics: Mapping the spatial distribution of OR10Q1 expression in the olfactory epithelium in relation to other receptors will provide insights into the organizational principles of the peripheral olfactory system.

These technologies would help address the challenges in studying olfactory receptors highlighted in the literature, such as their "extremely high genetic diversity" and the difficulty in understanding how SNPs "in the promoter region may considerably impair transcriptional regulation" .

How might CRISPR/Cas9 genome editing facilitate OR10Q1 functional studies?

CRISPR/Cas9 genome editing offers transformative approaches for OR10Q1 research:

  • Isogenic cell line development: Creation of cell lines differing only in specific OR10Q1 variants allows direct comparison of functional effects of individual SNPs or haplotypes.

  • Humanized animal models: Introduction of human OR10Q1 variants into model organisms enables in vivo studies of receptor function in the context of a complete olfactory system.

  • Promoter editing: Precise modification of OR10Q1 regulatory regions can reveal the functional significance of promoter SNPs on expression patterns and levels.

  • Reporter knock-ins: Integration of fluorescent or luminescent reporters downstream of the endogenous OR10Q1 promoter facilitates monitoring of expression dynamics in native contexts.

  • Multiplexed variant screening: Simultaneous creation and functional testing of multiple OR10Q1 variants using CRISPR libraries provides high-throughput assessment of structure-function relationships.

These approaches would be particularly valuable given findings that olfactory receptor genes show "an unusually high genetic diversity" with "functional differences at over 30% of their odorant receptor alleles" between individuals .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.