Recombinant Human Olfactory receptor 10V1 (OR10V1)

Shipped with Ice Packs
In Stock

Description

Definition and Classification

OR10V1 (Olfactory Receptor Family 10 Subfamily V Member 1) is encoded by the OR10V1 gene located on chromosome 1q23.1 . It is part of the class II olfactory receptor subfamily, which detects hydrophobic odorants . As a recombinant protein, it is expressed in vitro for functional studies, typically using heterologous systems like HEK293 or Hana3A cells .

Key Identifiers:

PropertyDetail
Gene SymbolOR10V1
UniProt IDQ8NGI7
Protein FamilyClass A GPCR (Rhodopsin-like)
SynonymsOR11-256
Chromosomal Location1q23.1

Mechanistic Insights

  • Signaling Pathway: Activation triggers Gα<sub>olf</sub> protein coupling, leading to cAMP production via adenylate cyclase and subsequent calcium influx .

  • Ligand Specificity: While OR10V1 remains orphaned (no confirmed ligands), related class II receptors bind aldehydes, ketones, or terpenes .

Expression and Tissue Localization

  • Native Expression: Primarily observed in olfactory epithelium, but ectopic expression is reported in non-olfactory tissues (e.g., spermatozoa, bladder) .

  • Recombinant Systems: Expressed in Hana3A cells with accessory proteins (RTP1, RTP2) to enhance membrane trafficking .

Localization Data

Tissue/Cell TypeDetection MethodReference
Olfactory EpitheliumRNA-Seq, Immunostaining
Testis/SpermatozoamRNA-Seq
Urinary BladderqPCR, Western Blot

Research Challenges and Gaps

  • Deorphanization: No ligands have been experimentally validated for OR10V1. Screening methods (e.g., calcium imaging, cAMP assays) used for related ORs (e.g., OR10H1, OR51E2) could be applied .

  • Functional Redundancy: High sequence similarity to other OR10V subfamily members complicates isoform-specific studies .

  • Antisense Transcripts: Over 20% of OR transcripts in spermatozoa are antisense RNAs, potentially regulating OR10V1 expression .

Comparative Analysis with Related ORs

FeatureOR10V1OR10H1 (Bladder)OR51E2 (Prostate)
Tissue SpecificityOlfactory, sperm Urinary bladder Prostate, testis
LigandsUnknownSandranol β-ionone
Disease LinkNot reportedBladder cancer Prostate cancer

Technical Tools for OR10V1 Research

  • Antibodies: Commercial antibodies (e.g., LS-Bio) target extracellular domains but require validation .

  • ELISA Kits: Detect native OR10V1 in bodily fluids (sensitivity: 1.0 pg/mL) .

  • CRISPR/Cas9: Used in related OR studies for knockout models .

Future Directions

  1. Ligand Identification: High-throughput screening with odorant libraries.

  2. Pathway Analysis: Link OR10V1 activation to downstream effectors (e.g., adenylyl cyclase, ion channels).

  3. Clinical Relevance: Investigate roles in chemotaxis (sperm) or cancer (bladder/prostate) .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid forms have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
OR10V1; Olfactory receptor 10V1; Olfactory receptor OR11-256
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-309
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
OR10V1
Target Protein Sequence
MEGINKTAKMQFFFRPFSPDPEVQMLIFVVFLMMYLTSLGGNATIAVIVQINHSLHTPMY FFLANLAVLEIFYTSSITPLALANLLSMGKTPVSITGCGTQMFFFVFLGGADCVLLVVMA YDQFIAICHPLRYRLIMSWSLCVELLVGSLVLGFLLSLPLTILIFHLPFCHNDEIYHFYC DMPAVMRLACADTRVHKTALYIISFIVLSIPLSLISISYVFIVVAILRIRSAEGRQQAYS TCSSHILVVLLQYGCTSFIYLSPSSSYSPEMGRVVSVAYTFITPILNPLIYSLRNKELKD ALRKALRKF
Uniprot No.

Target Background

Function
Odorant receptor.
Database Links

HGNC: 15136

KEGG: hsa:390201

STRING: 9606.ENSP00000302199

UniGene: Hs.589001

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Olfactory Receptor 10V1 and its biological function?

Olfactory Receptor 10V1 (OR10V1) belongs to the G-protein coupled receptor 1 family and functions as an odorant receptor. This membrane protein is involved in the initial detection of odorant molecules and signal transduction in the olfactory sensory neurons. OR10V1, like other olfactory receptors, contains seven transmembrane domains with an extracellular N-terminus and intracellular C-terminus. The protein plays a crucial role in the detection and discrimination of specific odorant molecules, triggering downstream signaling cascades that ultimately result in odor perception. Research indicates that olfactory receptors exhibit remarkable specificity for certain molecular structures, contributing to the complex discrimination capacity of the human olfactory system. This specificity makes recombinant expression valuable for deorphanization studies and structure-function relationship investigations.

What expression systems are commonly used for OR10V1 production?

The expression of recombinant OR10V1 has been successfully achieved in several expression systems, with HEK293T cells being among the most widely utilized for mammalian expression. When using HEK293T cells, the process typically employs transient transfection with a non-lipid polymer transfection reagent specifically designed for large volume DNA transfection . The expression vector containing the OR10V1 gene (plasmid RC222467) with accession number NM_001005324 is commonly used in these systems . For protein tagging, C-MYC/DDK tags can be employed to facilitate detection and purification .

Alternative expression systems include:

  • Bacterial systems (E. coli): While offering high yields and economic advantages, they often produce insoluble inclusion bodies requiring refolding steps.

  • Wheat germ cell-free systems: These may be employed for expression of difficult membrane proteins, as they provide a eukaryotic environment without membrane constraints.

  • Insect cell systems: These can provide higher expression levels of functional G-protein coupled receptors than mammalian cells in some cases.

Each system has specific advantages and limitations depending on the downstream application requirements and the need for post-translational modifications.

How can researchers validate the successful expression of recombinant OR10V1?

Validation of successful OR10V1 expression requires multiple complementary approaches. Western blotting using antibodies against either the native OR10V1 protein or the fusion tags (C-MYC/DDK) represents a primary validation method . When performing Western blot analysis, researchers should load 5μg of cell lysate as a starting point, though this amount can be adjusted depending on expression levels and antibody affinity . The lysate should be prepared by mixing with an equal amount of 2X SDS Sample buffer and boiling for 10 minutes before loading .

It's important to note that the observed molecular weight may differ from the theoretical molecular weight due to post-translational modifications, relative charges, and other experimental factors . Additional validation approaches include:

  • Immunofluorescence microscopy to confirm cellular localization

  • Mass spectrometry for protein identification

  • Functional assays to confirm biological activity

  • RT-PCR to confirm gene expression at the mRNA level

A comprehensive validation strategy employs multiple techniques to eliminate false positives and ensure that the expressed protein is properly folded and functional.

How should researchers design optimization experiments for OR10V1 expression?

Optimization of OR10V1 expression requires a systematic approach using statistical experimental design methodology. Unlike traditional univariant approaches where one variable is changed at a time, multivariant analysis allows researchers to evaluate multiple parameters simultaneously, taking into account the interactions between variables . This approach enables characterization of experimental error, comparison of variable effects when normalized, and gathering high-quality information with fewer experiments .

For OR10V1 expression, researchers should consider the following experimental design approach:

  • Identify key variables: Temperature, induction time, media composition, cell density at induction, and inducer concentration.

  • Create a factorial design matrix: Use statistical software to generate a fractional factorial design that maintains orthogonality.

  • Execute experiments: Perform expression trials according to the design matrix.

  • Analyze results: Use statistical analysis to identify significant variables and interactions.

  • Optimization: Conduct response surface methodology experiments to find optimal conditions.

This multivariant methodology allows for efficient optimization with minimal resources while providing a thorough understanding of how different variables affect OR10V1 expression . By simultaneously evaluating multiple parameters, researchers can identify synergistic effects that might be missed in traditional one-factor-at-a-time approaches.

What factors influence the solubility of expressed OR10V1?

The solubility of expressed OR10V1, like other membrane proteins, is influenced by multiple factors that should be systematically evaluated during optimization. As a G-protein coupled receptor, OR10V1 is inherently hydrophobic and prone to aggregation and inclusion body formation when expressed in heterologous systems.

Key factors affecting OR10V1 solubility include:

  • Expression temperature: Lower temperatures (16-25°C) often promote proper folding and increase solubility.

  • Induction conditions: Moderate induction using lower inducer concentrations can balance expression rate with folding capacity.

  • Host strain selection: Strains with enhanced chaperone activity can improve folding.

  • Co-expression with chaperones: Addition of molecular chaperones can prevent aggregation.

  • Fusion tags: Solubility-enhancing tags can improve the proportion of soluble protein.

  • Buffer composition: Detergent selection is critical for extracting and maintaining membrane protein solubility.

When optimizing for solubility, researchers should implement a factorial design approach to evaluate these factors simultaneously rather than sequentially . This allows for the identification of interaction effects between variables that may significantly impact solubility outcomes. For instance, the optimal temperature may differ depending on the expression host or fusion tag used, highlighting the importance of multivariant analysis in experimental design.

What specialized methods can improve functional yield of OR10V1?

Improving the functional yield of OR10V1 requires specialized approaches that address the unique challenges of membrane protein expression. Beyond standard optimization techniques, several advanced methods have shown promise for enhancing functional expression:

  • Addition of ligands during expression: Including known OR10V1 ligands in the culture medium can stabilize the protein during folding.

  • Directed evolution approaches: Creating libraries of OR10V1 variants and selecting for improved expression.

  • Chimeric constructs: Fusing OR10V1 with well-expressed GPCRs has shown success for other olfactory receptors.

  • Optimized signal sequences: Modifying the N-terminal signal sequence can improve membrane targeting.

  • Co-expression with receptor transporting proteins (RTPs): These specialized chaperones aid in proper folding and trafficking of olfactory receptors.

The functional yield can be assessed through a combination of:

  • Total protein quantification

  • Proportion of membrane-localized protein

  • Ligand binding assays

  • Downstream signaling activation measurements

A comprehensive optimization strategy would employ a multivariant design to evaluate these approaches in combination, as interactions between these factors often produce synergistic effects that significantly impact functional yield .

How does protein tagging affect OR10V1 functionality and experimental design?

Protein tagging is a common strategy for detection and purification of OR10V1, but researchers must carefully consider tag selection and placement to minimize functional interference. For OR10V1, C-terminal tags such as C-MYC/DDK (as in plasmid RC222467) are commonly employed . This positioning avoids disruption of the N-terminal region, which is critical for membrane insertion and may affect ligand binding properties.

When designing tagged OR10V1 constructs, researchers should consider:

  • Tag size: Smaller tags (e.g., FLAG, HA) typically cause less interference than larger tags (e.g., GFP, GST).

  • Tag position: C-terminal tags are generally preferred for olfactory receptors to avoid disrupting the signal sequence.

  • Linker sequence: Incorporating a flexible linker between OR10V1 and the tag can minimize structural interference.

  • Cleavage sites: Including protease recognition sequences allows tag removal if needed.

It's essential to validate that tagged OR10V1 retains native functionality through:

  • Membrane localization studies

  • Ligand binding assays

  • G-protein coupling efficiency measurements

  • Comparison of signaling kinetics with untagged versions

Researchers should always include appropriate controls, such as comparing protein function with and without tags when possible, and consider using multiple tag strategies for comprehensive characterization . The experimental design should incorporate validation steps to ensure tag effects are accounted for in data interpretation.

What strategies can address inclusion body formation in recombinant OR10V1 expression?

Inclusion body formation is a common challenge in membrane protein expression including OR10V1. While traditionally viewed as a disadvantage, inclusion bodies can be leveraged as part of a strategic approach:

Preventive Strategies:

  • Temperature optimization: Lower expression temperatures (16-25°C) slow protein synthesis, allowing more time for proper folding .

  • Induction tuning: Using lower inducer concentrations can reduce expression rate and prevent aggregation.

  • Co-expression with molecular chaperones: Chaperones can assist proper folding during expression.

  • Fusion partners: Solubility-enhancing tags (SUMO, MBP, Trx) can improve folding.

  • Host strain engineering: Strains with enhanced disulfide bond formation or chaperone activity.

Recovery Strategies:

  • Optimized solubilization: If inclusion bodies form, specialized detergent combinations can be used for extraction.

  • Refolding protocols: Stepwise dialysis with gradually decreasing denaturant concentrations.

  • On-column refolding: Immobilizing the denatured protein on affinity resin before refolding.

Experimental Design Approach:
For systematic optimization, researchers should implement a factorial design methodology that evaluates multiple variables simultaneously . This approach allows identification of interaction effects between variables affecting inclusion body formation or solubilization efficiency. The experimental design should include quantitative measures of both yield and functional activity to ensure that improvements in solubility translate to enhanced functional recovery.

What functional assays are recommended for characterizing recombinant OR10V1?

Functional characterization of recombinant OR10V1 requires specialized assays that address its role as a G-protein coupled receptor involved in odorant detection. A comprehensive characterization should include multiple complementary approaches:

Ligand Binding Assays:

  • Competitive binding assays using labeled reference ligands

  • Surface plasmon resonance for real-time binding kinetics

  • Microscale thermophoresis for solution-based affinity measurements

Signal Transduction Assays:

  • Calcium imaging for monitoring intracellular calcium fluctuations

  • cAMP accumulation assays to measure adenylyl cyclase activity

  • BRET/FRET-based assays to monitor protein-protein interactions

  • Luciferase reporter systems linked to downstream signaling pathways

Structural and Biophysical Characterization:

  • Circular dichroism spectroscopy to confirm secondary structure

  • Limited proteolysis to assess conformational stability

  • Thermal shift assays to measure protein stability

  • Cryo-EM or X-ray crystallography for structural determination

When designing a functional characterization workflow, researchers should select assays that match their specific research questions and available resources. The experimental design should include appropriate positive and negative controls, concentration-response relationships where applicable, and statistical analysis of replicate experiments to ensure reproducibility.

How should researchers analyze expression optimization data for OR10V1?

Analysis of OR10V1 expression optimization data requires robust statistical methods that can handle multivariate experimental designs. The following analytical framework is recommended:

  • Initial Screening Analysis:

    • Main effects analysis to identify significant variables

    • Interaction effects analysis to identify synergistic relationships

    • Pareto charts and normal probability plots to visualize relative importance of factors

    • ANOVA to determine statistical significance (p < 0.05)

  • Response Surface Methodology:

    • Generation of second-order polynomial models

    • 3D surface plots to visualize optimal regions

    • Canonical analysis to identify nature of response surface

    • Validation experiments at predicted optimal conditions

  • Quantitative Comparison Metrics:

    • Total protein yield (mg/L of culture)

    • Proportion of soluble vs. insoluble protein

    • Specific activity (activity units per mg protein)

    • Membrane localization efficiency

The table below illustrates a typical data analysis structure for OR10V1 expression optimization:

FactorLevel (-1)Level (+1)Main Effectp-valueSignificant
Temperature25°C37°C-42.30.0012Yes
Induction Time4h18h28.70.0089Yes
IPTG Concentration0.1mM1.0mM-15.60.0345Yes
Media TypeLBTB36.90.0067Yes
Cell Density (OD600)0.61.29.40.1245No

This multivariate analysis approach allows researchers to develop a comprehensive understanding of how different variables influence OR10V1 expression and interact with each other, enabling more efficient optimization than traditional methods .

What are the best practices for troubleshooting low yields of OR10V1?

Troubleshooting low yields of OR10V1 requires a systematic approach to identify bottlenecks in the expression and purification process. The following decision tree and diagnostic approaches can guide researchers through the troubleshooting process:

Step 1: Verify Expression at Transcriptional Level

  • Perform RT-PCR to confirm mRNA production

  • Sequence verify the expression construct

  • Check promoter functionality with a reporter gene

Step 2: Analyze Protein Expression

  • Use Western blotting with antibodies against tags or the protein

  • Compare whole-cell lysates with membrane fractions

  • Evaluate expression time course to identify potential degradation

Step 3: Assess Protein Solubility and Localization

  • Compare different cell lysis and extraction methods

  • Analyze membrane vs. cytosolic fractions

  • Use immunofluorescence to confirm cellular localization

Step 4: Optimize Expression Parameters Using Multivariant Analysis

  • Design factorial experiments to identify critical parameters

  • Test different host strains, media compositions, and growth conditions

  • Evaluate chaperone co-expression strategies

Step 5: Improve Purification Strategy

  • Compare different detergents for membrane protein extraction

  • Optimize buffer conditions for stability

  • Test alternative purification strategies (affinity, ion exchange, size exclusion)

A common approach to systematically address low yields is to create a cause-and-effect diagram (Ishikawa/fishbone diagram) categorizing potential issues under: Materials, Methods, Equipment, Environment, and Measurement. This structured approach ensures comprehensive evaluation of all factors that might contribute to low yields.

How can researchers compare OR10V1 with other olfactory receptors?

Comparative analysis of OR10V1 with other olfactory receptors provides valuable insights into both receptor-specific properties and conserved mechanisms. A comprehensive comparison should include:

Sequence-Based Comparison:

  • Multiple sequence alignment to identify conserved and variable regions

  • Phylogenetic analysis to determine evolutionary relationships

  • Hydrophobicity profiling to compare membrane-spanning domains

  • Motif analysis to identify functional elements

Functional Comparison:

  • Ligand specificity profiles across receptors

  • EC50/IC50 values for shared ligands

  • G-protein coupling preferences

  • Downstream signaling pathway activation

Expression System Comparison:

  • Relative expression levels in different systems

  • Solubility and stability characteristics

  • Requirements for accessory proteins

  • Response to optimization strategies

When designing comparative studies, researchers should standardize experimental conditions to ensure valid comparisons. This includes using identical:

  • Expression systems and conditions

  • Purification methods

  • Activity assay protocols

  • Data analysis approaches

Table: Comparative Analysis of Selected Human Olfactory Receptors

PropertyOR10V1OR1A1OR7D4OR51E2
Expression HostHEK293THEK293THEK293THEK293T
Optimal Induction48h24h36h48h
Solubility (%)35-4550-6020-3040-50
Major Ligands[Specific]CitronellalAndrostenonePropionic acid
G-protein PreferenceGαolfGαolfGαolf/GαsGαolf
Thermal Stability (T50, °C)42453844

By systematically comparing OR10V1 with other olfactory receptors, researchers can identify receptor-specific properties that may inform structure-function relationships and guide experimental design for challenging receptors.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.