Recombinant Human Olfactory receptor 10W1 (OR10W1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you require a specific format, please indicate your preference when placing the order. We will accommodate your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchase method and location. For specific delivery estimates, please consult your local distributor.
Note: All proteins are shipped with standard blue ice packs unless otherwise specified. Should you require dry ice shipping, please notify us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
We suggest centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the intrinsic stability of the protein.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form typically has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
OR10W1; OR10W1P; UNQ6469/PRO34070; Olfactory receptor 10W1; Olfactory receptor OR11-236
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-305
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
OR10W1
Target Protein Sequence
MEFVFLAYPSCPELHILSFLGVSLVYGLIITGNILIVVSIHTETCLCTSMYYFLGSLSGI EICYTAVVVPHILANTLQSEKTITLLGCATQMAFFIALGSADCFLLAAMAYDRYVAICHP LQYPLLMTLTLCVHLVVASVISGLFLSLQLVAFIFSLPFCQAQGIEHFFCDVPPVMHVVC AQSHIHEQSVLVAAILAIAVPFFLITTSYTFIVAALLKIHSAAGRHRAFSTCSSHLTVVL LQYGCCAFMYLCPSSSYNPKQDRFISLVYTLGTPLLNPLIYALRNSEMKGAVGRVLTRNC LSQNS
Uniprot No.

Target Background

Function
Odorant receptor.
Database Links

HGNC: 15139

KEGG: hsa:81341

STRING: 9606.ENSP00000378516

UniGene: Hs.531507

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Olfactory Receptor 10W1 and what is its molecular classification?

Olfactory Receptor 10W1 (OR10W1) is a member of the G-protein coupled receptor 1 family, similar to other olfactory receptors like OR10X1 . It functions as an odorant receptor, responding to specific molecular ligands. The full-length human OR10W1 protein contains approximately 309-320 amino acid residues, featuring the characteristic seven-transmembrane domain structure common to GPCRs. This receptor plays a key role in the olfactory transduction pathway, transforming chemical signals from odorants into electrical signals for neural processing. Understanding its structure-function relationship is essential for studying its ligand specificity and downstream signaling mechanisms.

What expression systems are most effective for producing Recombinant Human OR10W1?

Based on protocols established for similar olfactory receptors, wheat germ cell-free expression systems have proven effective for producing recombinant olfactory receptors . This expression system offers several advantages for OR10W1 production:

  • Enables proper folding of the complex seven-transmembrane structure

  • Minimizes toxicity issues often encountered with mammalian expression

  • Supports post-translational modifications required for functionality

  • Yields sufficient protein for analytical applications like ELISA and Western blotting

Alternative expression systems worth considering include HEK293 cells with specialized chaperones and modified insect cell lines. When selecting an expression system, researchers should consider the intended downstream applications and required protein yield.

How can researchers validate the expression and functionality of recombinant OR10W1?

Validation of recombinant OR10W1 expression and functionality requires a multi-faceted approach:

Expression Validation:

  • Western blotting using specific OR10W1 antibodies

  • Immunocytochemical staining in transfected cells (e.g., Hana3A cells which express accessory proteins needed for proper OR membrane targeting)

  • qRT-PCR for transcript detection

Functionality Assessment:

  • Calcium influx assays following potential ligand stimulation

  • cAMP measurements to detect G-protein coupling

  • CRE-Luciferase reporter gene assays similar to those used for other ORs

  • Adenylyl cyclase activation assays

For optimal results, researchers should include positive controls (known functional ORs) and negative controls (mock-transfected cells) in all validation experiments.

What are the common challenges in studying OR10W1 and how can they be addressed?

Researching OR10W1 presents several methodological challenges:

ChallengeDescriptionMitigation Strategies
Poor surface expressionORs often have difficulty reaching the cell membraneUse specialized accessory proteins (e.g., RTP1S, Ric8b); optimize with rhodopsin signal sequences
Ligand identificationFinding specific activators is complexImplement systematic deorphanization screening with diverse odorant libraries
Antibody specificityCross-reactivity with other ORsValidate antibodies in OR10W1-transfected cells vs. controls
Functionality assessmentConfirming OR activityEmploy multiple orthogonal assays (calcium imaging, cAMP detection)
Expression variabilityInconsistent expression levelsStandardize transfection protocols and include internal controls

These challenges require careful experimental design and appropriate controls to ensure reproducible results.

What experimental designs are most appropriate for OR10W1 deorphanization studies?

Deorphanization studies aim to identify ligands that activate OR10W1. Based on successful approaches with other olfactory receptors, the following experimental design is recommended:

  • Preparation Phase:

    • Express OR10W1 in a heterologous system (e.g., Hana3A cells that express necessary accessory proteins)

    • Verify expression using immunocytochemistry

    • Establish assay sensitivity using positive controls (e.g., forskolin for cAMP pathways)

  • Screening Phase:

    • Implement true experimental research design with randomized compounds

    • Use control vs. experimental groups to minimize bias

    • Apply systematic variable manipulation of potential ligands (concentration ranges, structural analogs)

  • Validation Phase:

    • Confirm hits with dose-response relationships

    • Use multiple downstream assays (calcium imaging, cAMP, reporter assays)

    • Apply antagonists or inhibitors (e.g., SQ22536 for adenylyl cyclase)

For experimental rigor, researchers should ensure:

  • Random distribution of variables to control for plate effects

  • Inclusion of positive and negative controls in each experiment

  • Blinding of experimenters to test compounds during analysis

  • Statistical power calculations to determine appropriate sample sizes

How can researchers distinguish the physiological functions of OR10W1 from other closely related receptors?

Distinguishing OR10W1 from related olfactory receptors requires specialized experimental approaches:

Molecular Level Differentiation:

  • Gene expression profiling across tissues to establish expression patterns

  • Transcript detection in relevant tissues using highly specific primers

  • Protein localization studies with validated antibodies

Functional Differentiation:

  • Comparative ligand response profiles using identical assay conditions

  • Cross-desensitization experiments to identify shared vs. unique ligands

  • Mutational analysis of key binding residues to map ligand specificity determinants

Cellular/Tissue Level Approaches:

  • Gene silencing with siRNA/shRNA specifically targeting OR10W1

  • CRISPR-Cas9 knockout models to generate OR10W1-deficient cells

  • Rescue experiments with exogenous OR10W1 expression

These approaches provide complementary data to build a comprehensive picture of OR10W1's unique functions compared to other ORs.

What methodologies are most effective for studying OR10W1's signaling pathways?

Understanding OR10W1 signaling requires sophisticated methodological approaches:

  • Canonical GPCR Signaling Assessment:

    • Measure G-protein subtype coupling (Gαolf, Gαs, Gαi, Gαq) using BRET/FRET sensors

    • Quantify second messenger production (cAMP, calcium, IP3) following stimulation

    • Assess adenylyl cyclase activation, particularly adenylyl cyclase 3, which is important in olfactory signaling

  • Downstream Pathway Analysis:

    • Phosphoproteomic profiling following receptor activation

    • Transcriptional response analysis (e.g., RNA-seq before/after stimulation)

    • Pharmacological inhibition of pathway components to map signaling cascade

  • Functional Consequences:

    • Cell proliferation assays to assess growth regulatory effects

    • Migration assays to evaluate cellular motility impacts

    • Cell cycle analysis to detect arrest patterns (G1/S/G2)

    • Apoptosis quantification using multiple detection methods

For comprehensive pathway mapping, researchers should combine temporal analysis (early vs. late responses) with dose-dependency studies to distinguish primary from secondary effects.

How can tissue-specific expression of OR10W1 be accurately quantified and validated?

Accurate quantification of OR10W1 expression requires rigorous methodology:

Transcript Quantification:

  • Digital droplet PCR for absolute quantification

  • RNA-seq with appropriate normalization for relative expression across tissues

  • Single-cell RNA-seq to identify specific cell populations expressing OR10W1

  • qRT-PCR with multiple reference genes for reliable normalization

Protein Quantification:

  • Western blotting with recombinant protein standards for calibration

  • Mass spectrometry-based targeted proteomics

  • Immunohistochemistry with digital image analysis for semi-quantitative assessment

  • Flow cytometry for cell-type specific quantification

Validation Approaches:

  • In situ hybridization to confirm transcript localization

  • Dual labeling with cell-type specific markers

  • Multi-site sampling within tissues to account for regional variations

  • Comparison across multiple individuals to account for biological variability

A comprehensive approach might involve analyzing transcriptomes across multiple tissues, similar to the approach used for OR10H1 which showed tissue-specific expression patterns .

What are the best experimental designs for studying OR10W1 in disease models?

When investigating OR10W1's potential role in disease:

  • Case-Control Studies:

    • Compare OR10W1 expression between diseased and healthy tissues

    • Analyze paired samples (tumor/normal) to control for individual variation

    • Use large sample sizes with appropriate statistical power calculations

  • Disease Model Development:

    • Generate cell lines with modulated OR10W1 expression

    • Establish animal models with tissue-specific OR10W1 alterations

    • Create patient-derived organoids to study OR10W1 in disease context

  • Functional Assessment:

    • Examine phenotypic changes following OR10W1 modulation

    • Analyze downstream molecular pathways altered in disease states

    • Test potential therapeutic interventions targeting OR10W1

  • Biomarker Validation:

    • Assess OR10W1 transcript levels in accessible biofluids

    • Evaluate sensitivity and specificity in defined patient cohorts

    • Perform longitudinal studies to determine prognostic value

Research on similar olfactory receptors like OR10H1 has demonstrated their potential roles in diseases such as bladder cancer, where specific expression patterns and functional consequences were observed .

How should researchers design controls for OR10W1 functional studies?

Robust control design is critical for OR10W1 research:

Negative Controls:

  • Mock-transfected cells (plasmid without OR10W1)

  • Cells expressing non-functional OR10W1 mutants

  • Vehicle-only treatments for ligand studies

  • Non-specific IgG for immunoprecipitation studies

Positive Controls:

  • Forskolin stimulation for cAMP-dependent pathways

  • Calcium ionophores for calcium-dependent assays

  • Well-characterized ORs with known responses

  • Recombinant OR10W1 protein standards for expression studies

Validation Controls:

  • Dose-response relationships to confirm specific interactions

  • Competitive binding studies with known ligands

  • Pathway inhibitors to confirm signaling mechanisms

  • Genetic knockdown to verify receptor-specific effects

Implementing these controls enhances experimental rigor and reproducibility.

What considerations are important when analyzing contradictory data in OR10W1 research?

When confronting contradictory findings in OR10W1 research:

  • Methodological Variations Analysis:

    • Compare experimental designs for procedural differences

    • Examine cell types/expression systems used (effects on receptor functionality)

    • Assess reagent sources and validation (especially antibodies)

    • Review statistical approaches and threshold criteria

  • Biological Variability Assessment:

    • Consider genetic variations in OR10W1 sequence

    • Examine potential splice variants or post-translational modifications

    • Assess heterogeneity of cell populations or tissue samples

    • Evaluate environmental/experimental factors affecting receptor function

  • Resolution Strategies:

    • Design experiments specifically addressing contradictions

    • Implement multiple orthogonal methods to validate findings

    • Collaborate with labs reporting different results

    • Perform meta-analysis of available data when appropriate

Systematic investigation of contradictory results often leads to deeper insights into receptor biology and methodological refinements.

What emerging technologies could advance OR10W1 research?

Several cutting-edge technologies show promise for advancing OR10W1 research:

TechnologyApplication to OR10W1 ResearchAdvantages
Cryo-EMStructural determination of OR10W1Enables visualization of receptor-ligand interactions in near-native state
AlphaFold/RoseTTAFoldComputational structure predictionAccelerates understanding of structure-function relationships
CRISPR-based screensSystematic functional genomicsIdentifies genes affecting OR10W1 expression and function
Single-cell multi-omicsCell-specific expression patternsReveals heterogeneity in OR10W1 expression and response
Organoids3D tissue culture modelsProvides physiologically relevant systems for functional studies
BiosensorsReal-time signaling detectionEnables dynamic monitoring of OR10W1 activation in living cells
MetabolomicsComprehensive ligand screeningIdentifies endogenous activators from complex biological samples

Combining these approaches creates unprecedented opportunities to understand OR10W1 biology comprehensively.

How can researchers effectively design studies to identify physiological roles of OR10W1 beyond olfaction?

To investigate non-canonical functions of OR10W1:

  • Expression Analysis Strategy:

    • Conduct comprehensive tissue expression profiling

    • Identify cell types expressing OR10W1 outside olfactory epithelium

    • Correlate expression with physiological or pathological states

  • Functional Investigation Design:

    • Implement loss-of-function and gain-of-function experiments in relevant cell types

    • Design tissue-specific conditional knockout models

    • Utilize inducible expression systems to control temporal activation

  • Molecular Characterization Approach:

    • Identify tissue-specific signaling pathways coupled to OR10W1

    • Compare ligand sensitivity across different tissue contexts

    • Investigate potential receptor interactions and complexes

Recent findings with OR10H1 in bladder tissue demonstrate the importance of investigating olfactory receptors in non-olfactory tissues, revealing potential roles in cellular proliferation, migration, and cell cycle regulation .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.