Recombinant Human Olfactory receptor 12D2 (OR12D2)

Shipped with Ice Packs
In Stock

Description

Molecular Structure and Genomic Context

OR12D2 is a 307-amino acid protein encoded by the OR12D2 gene (Gene ID: 26529) located on chromosome 6p22.1 . Its structure includes:

  • Seven transmembrane domains (TM1–TM7), characteristic of GPCRs .

  • N-terminal His-tag (6xHis) for purification and stability .

  • Partial or full-length constructs, depending on production systems (e.g., E. coli or yeast) .

PropertyDetail
Gene LocationChromosome 6p22.1 (NC_000006.12)
Alternative NamesHs6M1-20, Olfactory Receptor OR6-28
Uniprot IDP58182

Key Production Parameters

ParameterValue
Expression HostE. coli (full-length) , Saccharomyces cerevisiae (partial)
Purity>90% (SDS-PAGE) ; >85% (yeast-derived)
FormLyophilized powder (Tris/PBS buffer, 6% trehalose)
ReconstitutionDeionized water (0.1–1.0 mg/mL) with 5–50% glycerol

Storage:

  • Long-term: -20°C/-80°C (avoid repeated freeze-thaw cycles) .

  • Short-term: 4°C for ≤1 week .

Functional Applications

OR12D2 is utilized in:

  • SDS-PAGE analysis to validate protein integrity .

  • Ligand screening to identify odorant agonists (no physiological ligands confirmed) .

  • Calcium imaging assays to study signaling pathways in olfactory cells .

Role in Autism Spectrum Disorder (ASD)

Exome-wide studies in Saudi females identified OR12D2 variants as risk factors for ASD:

  • SNPs: rs2073154C, rs2073153T, rs2073151G (linked to OR5V1 via high LD) .

  • Mechanism: Olfactory receptor dysfunction may impair neurodevelopmental signaling, contributing to ASD phenotypes .

Expression in Human Spermatozoa

While OR12D2 itself is not directly implicated in sperm function, related olfactory receptors (e.g., OR2H1/2, OR10J1) show localized expression in sperm compartments, suggesting potential roles in chemotaxis or fertilization .

Genetic Variability and Pseudogene Status

  • Segregating pseudogene: Some alleles encode functional receptors, while others are non-functional due to mutations .

  • Linkage disequilibrium (LD): Limited LD with MHC genes on chromosome 6, reducing evolutionary pressures for haplotype conservation .

Comparative Data: Recombinant OR12D2 Products

Product CodeSourceTagPurityApplication
RFL5584HFE. coliHis-tag>90%SDS-PAGE, ligand studies
CSB-YP016454HU1S. cerevisiaeN/A (partial)>85%Structural studies

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format readily available in our inventory. However, if you have a specific format preference, please indicate it in your order remarks. We will fulfill your request if possible.
Lead Time
Delivery times can vary depending on the purchasing method and location. Kindly consult your local distributors for specific delivery estimates.
Note: All our proteins are shipped with standard blue ice packs unless otherwise specified. Should you require dry ice shipping, please inform us beforehand, as additional fees will apply.
Notes
Repeated freezing and thawing is discouraged. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to concentrate the contents. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. For long-term storage, we suggest adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our standard final glycerol concentration is 50%, serving as a reference point.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid forms is 6 months at -20°C/-80°C. For lyophilized forms, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Minimize repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is established during the production process. If you have a specific tag type requirement, please inform us. We will prioritize developing the specified tag if possible.
Synonyms
OR12D2; Olfactory receptor 12D2; Hs6M1-20; Olfactory receptor OR6-28
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-307
Protein Length
Full length protein
Species
Homo sapiens (Human)
Target Names
OR12D2
Target Protein Sequence
MLNTTSVTEFLLLGVTDIQELQPFLFVVFLTIYFISVTGNGAVLMIVISDPRLHSLMYFF LGNLSYLDICYSTVTLPKMLQNFLSTHKAISFLGCISQLHFFHSLGSTESMLFAVMAFDL SVAICKPLRYTVIMNPQLCTQMAITIWVIGFFHALLHSVMTSRLNFCGSNRIHHFLCDIK PLLKLACGNTELNQWLLSTVTGTIAMGPFFLTLLSYFYIITYLFFKTRSCSMLCKALSTC ASHFMVVILFYAPVLFTYIHPALESFMDQDRIVAIMYTVVTPVLNPLIYTLRNKEVKGAL GRVIRRL
Uniprot No.

Target Background

Function
Odorant receptor.
Database Links

HGNC: 8178

KEGG: hsa:26529

STRING: 9606.ENSP00000373047

UniGene: Hs.247862

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Olfactory Receptor 12D2 (OR12D2) and what is its genomic location?

Olfactory Receptor 12D2 (OR12D2) is a G protein-coupled receptor belonging to the olfactory receptor family. It is also known by alternative names including Hs6M1-20 and Olfactory receptor OR6-28. The gene is located on chromosome 6, where it clusters with other olfactory receptor genes including OR11A1 and OR10C1, with which it shares high linkage disequilibrium . The UniProt ID for OR12D2 is P58182 . The full-length human OR12D2 protein consists of 307 amino acids and functions as a chemosensory receptor that detects odorant molecules in the olfactory epithelium, triggering neuronal responses that ultimately lead to the perception of smell.

What expression systems are most effective for producing recombinant OR12D2?

Two primary expression systems have been documented for recombinant OR12D2 production:

Expression SystemTagProtein LengthPuritySource
E. coliN-terminal His tagFull-length (1-307)>90% (SDS-PAGE)
BaculovirusVariable (determined during manufacturing)Partial>85% (SDS-PAGE)

Each system offers distinct advantages. The E. coli system typically provides higher yields and is more cost-effective but may present challenges with proper folding of membrane proteins. The Baculovirus system often produces proteins with more native-like post-translational modifications and proper folding, which can be crucial for functional studies of GPCRs like OR12D2 .

What are the optimal storage and handling conditions for recombinant OR12D2?

For optimal stability and activity retention, recombinant OR12D2 requires specific storage and handling conditions:

  • Storage Temperature: Store at -20°C or -80°C for long-term storage

  • Buffer Composition: Typically stored in Tris/PBS-based buffer with 6% Trehalose, pH 8.0

  • Glycerol Addition: Addition of 5-50% glycerol (final concentration) is recommended for freeze-thaw stability

  • Aliquoting: Create working aliquots to avoid repeated freeze-thaw cycles

  • Working Storage: For short-term use, store working aliquots at 4°C for up to one week

  • Shelf Life: Liquid form typically has a shelf life of 6 months at -20°C/-80°C; lyophilized form has a shelf life of 12 months

Repeated freezing and thawing should be avoided as this can significantly degrade protein quality and functional activity .

How should researchers design cell-based functional assays for OR12D2?

When designing cell-based assays to investigate OR12D2 function:

  • Cell Line Selection: Choose heterologous expression systems that support GPCR trafficking and signaling (e.g., HEK293 cells)

  • Receptor Expression Construct: Include trafficking enhancers (e.g., N-terminal tags) that improve surface expression

  • Signaling Components: Co-express necessary G proteins (typically Gαolf for ORs) and other signaling components

  • Response Measurement: Incorporate calcium indicators or cAMP sensors to detect receptor activation

  • Controls: Include positive controls (known responding ORs) and negative controls (non-responding ORs or empty vector)

  • Dose-Response Analysis: Test odorants across a concentration range (typically 1 nM to 1 mM)

These assays have successfully demonstrated OR12D2's response to 2-ethylfenchol, providing a mechanistic explanation for genetic associations with perception .

How can researchers address linkage disequilibrium challenges when studying OR12D2?

OR12D2 exists in a genomic cluster with OR11A1 and OR10C1 on chromosome 6, with high linkage disequilibrium (>60% correlation in the 1000 Genomes Project EUR superpopulation data) . This creates significant challenges for genetic association studies. To overcome these limitations:

  • Functional Validation: Utilize cell-based assays to directly test each receptor's response to the odorant of interest

  • Fine Mapping: Perform detailed haplotype analysis across the genomic region

  • Cross-Population Studies: Leverage different linkage patterns across diverse populations

  • CRISPR-Based Approaches: Use gene editing to modify specific receptors and test phenotypic effects

  • Expression Analysis: Correlate receptor expression levels with genotype and perception

These approaches helped researchers determine that OR12D2 was functionally responsive to 2-ethylfenchol in vitro, distinguishing it from nearby ORs that showed significant genetic association due to linkage disequilibrium .

What is the relationship between OR12D2 genetic variants and olfactory perception?

Research has demonstrated meaningful correlations between OR12D2 genetic variation and olfactory perception:

  • Odor Intensity: Genetic variations in OR12D2 correlate with changes in the perceived intensity of specific odorants, particularly 2-ethylfenchol

  • Pleasantness Perception: Genetic variations also influence the subjective pleasantness ratings of certain odorants

  • Loss of Function Effects: Loss-of-function variants in OR12D2 appear to alter both intensity and pleasantness perception of specific odorants

  • Receptor Functionality: In vitro assays confirm that OR12D2 responds to odorants that show genetic association with perception

These findings suggest that OR12D2 plays a direct role in the perception of specific odorants, and that genetic variation in this receptor contributes to individual differences in olfactory perception .

How should researchers interpret the relationship between in vitro OR12D2 activation and in vivo perception?

The relationship between in vitro receptor activation and in vivo perception requires careful interpretation:

  • Enrichment of Functional Receptors: ORs that respond in vitro are enriched in the set of receptors that are perceptually relevant, suggesting that in vitro assays can identify behaviorally important receptors

  • Expression Correlation: Functionally responsive ORs (including OR12D2) are more likely to be expressed in the human olfactory epithelium

  • Expression Level Significance: Deorphanized or perceptually relevant ORs are expressed at 1.5-fold higher levels than other intact ORs (P < 0.0001 via binomial test)

  • Predictive Value: Cell-based assays provide valuable evidence for validating genetic associations, with a higher hit rate (approximately 30% based on the studies) than expected by chance (approximately 12%)

These observations suggest that cell-based assays are a useful proxy for identifying behaviorally relevant ORs that are expressed in the olfactory epithelium and whose activation can be directly tied to perception .

What statistical approaches are appropriate for analyzing OR12D2 genetic association studies?

When analyzing genetic association data for OR12D2:

  • Linkage Disequilibrium Correction: Account for the high linkage disequilibrium with nearby ORs (OR11A1, OR10C1)

  • False Discovery Rate Control: Implement appropriate multiple testing corrections (the referenced study had an FDR of 66% for their top 50 associations)

  • Functional Validation: Complement statistical associations with in vitro functional data

  • Effect Size Estimation: Quantify the magnitude of effect for different genetic variants on perception

  • Population Stratification: Control for potential confounding from population structure in diverse cohorts

  • Haplotype Analysis: Consider analyzing haplotypes rather than individual SNPs to capture combined effects

These approaches help distinguish true positive associations from false positives and overcome the challenges posed by the genomic architecture of olfactory receptor gene clusters .

What are the critical quality control parameters for recombinant OR12D2 preparations?

To ensure high-quality recombinant OR12D2 for research applications:

  • Purity Assessment: Verify protein purity via SDS-PAGE (>90% for E. coli-derived protein, >85% for Baculovirus-derived protein)

  • Identity Confirmation: Confirm protein identity via western blot or mass spectrometry

  • Proper Reconstitution: For lyophilized protein, ensure proper reconstitution to a concentration of 0.1-1.0 mg/mL

  • Stability Verification: Validate protein stability after reconstitution and storage

  • Functional Testing: When possible, verify functional activity in an appropriate assay system

  • Storage Compliance: Store according to recommended conditions (with appropriate glycerol concentration, aliquoting, and temperature)

Implementing these quality control measures helps ensure that experimental findings are reliable and reproducible .

How can researchers troubleshoot non-responsive OR12D2 in functional assays?

When OR12D2 fails to show expected responses in functional assays:

  • Protein Integrity: Verify the integrity of the receptor using SDS-PAGE and western blot

  • Surface Expression: Confirm proper trafficking to the cell surface using surface labeling techniques

  • Signaling Components: Ensure all necessary signaling components (G proteins, RTP1S, etc.) are present

  • Assay Sensitivity: Validate assay sensitivity using positive controls (known receptor-ligand pairs)

  • Concentration Range: Test a wider concentration range of odorants (typically 1 nM to 1 mM)

  • Buffer Composition: Optimize buffer composition for receptor stability and function

  • Expression Level: Verify expression level through qPCR or western blot analysis

These troubleshooting steps can help identify and address issues that may prevent successful detection of OR12D2 responses in functional assays .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.