Recombinant Human Olfactory receptor 12D3 (OR12D3)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Human Olfactory Receptor 12D3 (OR12D3)

Recombinant Human Olfactory Receptor 12D3 (OR12D3) is a protein belonging to the olfactory receptor family, specifically the subfamily 12, member D3. Olfactory receptors are G protein-coupled receptors that play a crucial role in detecting odor molecules in the human nose. These receptors are responsible for converting chemical signals from odorants into electrical signals that are interpreted by the brain as specific smells.

Structure and Function

OR12D3, like other olfactory receptors, is a transmembrane protein with seven transmembrane domains. It is encoded by the OR12D3 gene located on chromosome 6 in humans . The recombinant form of this receptor is produced using biotechnological methods, allowing for its expression in various cell systems for research purposes.

FeatureDescription
Gene LocationChromosome 6
Protein TypeTransmembrane G protein-coupled receptor
FunctionDetection of specific odor molecules

Research and Applications

Research on recombinant olfactory receptors, including OR12D3, involves studying their specificity and sensitivity to different odorants. This is typically done by expressing the receptors in heterologous systems such as HEK293 cells or Xenopus laevis oocytes, as demonstrated with another olfactory receptor, OR17-40 . Such studies help in understanding how these receptors contribute to the complex process of smell perception.

Research MethodDescription
Cell SystemsHEK293 cells, Xenopus laevis oocytes
Odorant ScreeningIdentifying specific odorants that activate the receptor

Recombinant Production

Recombinant Human Olfactory Receptor 12D3 is produced using recombinant DNA technology. This involves cloning the OR12D3 gene into an expression vector and then expressing it in a suitable host cell line. The recombinant protein can be used for various biochemical and biophysical studies, including ligand binding assays and structural analysis.

Production MethodDescription
CloningInsertion of OR12D3 gene into an expression vector
Host CellsTypically mammalian or insect cell lines

Available Products and Tools

Several companies offer recombinant OR12D3 proteins or related antibodies for research purposes. For example, Sigma-Aldrich provides an anti-OR12D3 antibody for Western blot and ELISA applications . Cusabio also offers recombinant human OR12D3 protein .

ProductSupplierApplication
Anti-OR12D3 AntibodySigma-AldrichWestern Blot, ELISA
Recombinant OR12D3 ProteinCusabioBiochemical studies

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that is currently in stock. However, if you have a specific requirement for the format, please indicate your preference when placing the order. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery time information.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For short-term storage, working aliquots can be stored at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents are at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's intrinsic stability.
Generally, the shelf life for liquid form is 6 months at -20°C/-80°C. The shelf life for lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
OR12D3; Olfactory receptor 12D3; Hs6M1-27; Olfactory receptor OR6-27
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-316
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
OR12D3
Target Protein Sequence
MENVTTMNEFLLLGLTGVQELQPFFFGIFLIIYLINLIGNGSILVMVVLEPQLHSPMYFF LGNLSCLDISYSSVTLPKLLVNLVCSRRAISFLGCITQLHFFHFLGSTEAILLAIMAFDR FVAICNPLRYTVIMNPQVCILLAAAAWLISFFYALMHSVMTAHLSFCGSQKLNHFFYDVK PLLELACSDTLLNQWLLSIVTGSISMGAFFLTLLSCFYVIGFLLFKNRSCRILHKALSTC ASHFMVVCLFYGPVGFTYIRPASATSMIQDRIMAIMYSAVTPVLNPLIYTLRNKEVMMAL KKIFGRKLFKDWQQHH
Uniprot No.

Target Background

Function
Odorant receptor.
Database Links

HGNC: 13963

KEGG: hsa:81797

STRING: 9606.ENSP00000366348

UniGene: Hs.272280

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is OR12D3 and what is its functional significance in human biology?

Olfactory receptor 12D3 (OR12D3) is a protein encoded by the OR12D3 gene located on chromosome 6p22.1 in humans . It belongs to the large family of olfactory receptors that function as G-protein-coupled receptors (GPCRs) . These receptors interact with odorant molecules in the nasal epithelium to initiate neuronal responses that trigger smell perception .

OR12D3 is structurally characterized by a 7-transmembrane domain configuration common to GPCRs, arising from a single coding-exon gene . The protein consists of 316 amino acids and has a molecular weight of approximately 35.8 kDa . The functional significance of OR12D3 extends beyond basic olfaction, as evidenced by its genetic association with smoking behavior in certain populations, suggesting a potential role in chemosensory-influenced behaviors .

What expression systems are most effective for producing recombinant OR12D3?

Several expression systems have demonstrated efficacy for recombinant OR12D3 production:

Expression SystemAdvantagesConsiderationsApplications
HEK-293 CellsMammalian post-translational modifications, higher likelihood of proper foldingMore expensive, longer production timeFunctional studies, structural analyses
Wheat germ cell-free systemRapid production, eukaryotic machineryMay lack some mammalian-specific modificationsAntibody production, protein-protein interaction studies
Cell-free protein synthesis (CFPS)High yield, rapid turnaroundMay require optimization for membrane proteinsInitial screening, mutational analyses

For functional studies, mammalian expression systems such as HEK-293 cells are generally preferred as they provide the cellular environment most similar to the native context, facilitating proper folding and post-translational modifications essential for receptor functionality .

What purification strategies yield the highest quality recombinant OR12D3?

Purification of functional OR12D3 requires specialized approaches due to its hydrophobic transmembrane domains. The following methodological workflow has proven effective:

  • Affinity purification: Utilizing fusion tags (His, Strep, or GST) for initial capture. His-tagged OR12D3 can be purified using nickel affinity chromatography under optimized detergent conditions .

  • Detergent selection: Critical for maintaining protein stability and function during extraction from membranes. Mild detergents like DDM (n-Dodecyl β-D-maltoside) or LMNG (Lauryl maltose neopentyl glycol) preserve structural integrity better than harsher detergents.

  • Quality assessment: Purity should be verified through SDS-PAGE, Western blot, and analytical size exclusion chromatography (SEC) . Functional integrity can be assessed through ligand binding assays.

  • Storage considerations: OR12D3 stability is optimized at -80°C, with avoidance of repeated freeze-thaw cycles .

How does the Thr97Ile polymorphism (rs3749971 T) affect OR12D3 function and what methodologies best capture these effects?

The Thr97Ile polymorphism in OR12D3 (rs3749971 T) represents a nonsynonymous SNP that affects a putative ligand binding region of the receptor . This polymorphism has been significantly associated with smoking behavior in Caucasian women (p = 1.05×10^-2), with higher statistical significance than its linked HLA haplotype A1-B8-DR3 (p = 2.38×10^-2) .

Methodological approaches for functional characterization:

  • Heterologous expression systems: Express both wild-type and Thr97Ile variant receptors in HEK293 cells with fluorescent calcium indicators to measure ligand-induced signaling.

  • Computational modeling: Molecular dynamics simulations based on GPCR structural homology models can predict how the 97Thr → Ile exchange alters the receptor's ligand binding pocket .

  • Comparative analysis: Residue 97 is located at the junction of the first extracellular loop and the third transmembrane domain, a region critical for ligand binding in olfactory receptors, similar to positions that affect odor sensitivity in other ORs (e.g., positions 88 and 133 in OR7D4) .

  • Ligand screening: Systematic screening with diverse odorants, particularly those present in cigarette smoke, can identify differential responses between wild-type and variant receptors.

The experimental evidence suggests that the Thr97Ile variant alters the ligand binding properties of OR12D3, potentially affecting the perception of specific components in cigarette smoke, which may influence smoking behavior .

What CRISPR-based approaches are optimal for studying OR12D3 expression and function?

CRISPR technology offers powerful tools for OR12D3 research, particularly through activation systems that allow for controlled upregulation of endogenous OR12D3 expression:

CRISPR Activation (CRISPRa) System for OR12D3:

The synergistic activation mediator (SAM) transcription activation system provides a robust method for maximizing endogenous OR12D3 gene expression . This system employs:

  • A deactivated Cas9 (dCas9) nuclease with D10A and N863A mutations fused to a VP64 activation domain

  • A target-specific sgRNA engineered to bind the MS2-P65-HSF1 fusion protein

  • Plasmid vectors specifically designed for human OR12D3 targeting that map to the 6p22.1 genetic locus

Implementation protocol:

  • Transfect target cells with the OR12D3 CRISPR Activation Plasmid system

  • Select for successfully transfected cells using appropriate markers

  • Validate activation through qRT-PCR and Western blot analysis

  • Perform functional assays to assess the impact of increased OR12D3 expression

This approach allows for the study of OR12D3 in its native genomic context while avoiding the limitations associated with exogenous overexpression systems, particularly important for GPCRs that often require specific cellular environments for proper folding and function .

What experimental systems best recapitulate the functional properties of OR12D3 for ligand discovery?

Identifying ligands for orphan olfactory receptors like OR12D3 presents significant challenges. The following experimental systems have proven most effective:

1. Nanodiscs for OR12D3 functional reconstitution:

Synthetic nanodiscs provide a controlled lipid bilayer environment that better mimics the native membrane context of OR12D3 . This system allows for:

  • Precise control of lipid composition

  • Stabilization of the seven-transmembrane structure

  • Direct access to both extracellular and intracellular domains

  • Enhanced protein stability compared to detergent-solubilized preparations

2. High-throughput calcium imaging assays:

  • Heterologous expression of OR12D3 in HEK293 cells with Gα15/16 proteins

  • Automated calcium flux measurements upon ligand stimulation

  • Systematic screening of odorant libraries

  • Quantitative dose-response analyses

3. Computational approaches for rational ligand prediction:

Molecular modeling of OR12D3 based on recent GPCR crystal structures, particularly the human β2 adrenergic receptor, can guide rational prediction of potential ligands . The structural information places residue 97 (affected by the Thr97Ile polymorphism) near the ligand binding site, providing valuable insights for screening efforts.

4. Bioluminescence resonance energy transfer (BRET) assays:

BRET enables real-time monitoring of OR12D3 conformational changes and protein-protein interactions following ligand binding, offering higher sensitivity than traditional calcium signaling assays for detecting subtle ligand interactions.

How can researchers investigate the link between OR12D3 polymorphisms and smoking behavior?

The established association between the OR12D3 rs3749971 T allele and smoking behavior offers an intriguing translational research direction . A comprehensive investigation would include:

1. Genotype-phenotype correlation studies:

  • Cohort design: Stratify subjects based on OR12D3 genotype (Thr97Ile polymorphism)

  • Phenotypic assessments: Detailed smoking behavior questionnaires, biomarkers of nicotine metabolism

  • Control for confounding factors: Demographic variables, other genetic influences

2. Functional sensory testing:

  • Psychophysical evaluations of sensitivity to cigarette smoke components

  • Comparative testing between individuals with different OR12D3 genotypes

  • Correlation of perceptual differences with smoking initiation and maintenance

3. In vitro receptor characterization:

  • Heterologous expression of wild-type and Thr97Ile variant receptors

  • Screening against a panel of cigarette smoke constituents

  • Quantitative analysis of receptor activation profiles and downstream signaling

4. Integration with HLA haplotype analysis:

Since the OR12D3 polymorphism shows linkage disequilibrium with the A1-B8-DR3 HLA haplotype, integrated analysis of both genetic factors can provide insights into potential immunological influences on smoking behavior .

What methodological approaches best address the challenges in functional expression of recombinant olfactory receptors like OR12D3?

Olfactory receptors present unique challenges for recombinant expression due to poor membrane targeting, misfolding, and low stability. The following methodological strategies can overcome these limitations:

1. Fusion protein approaches:

  • Rhodopsin N-terminal fusion: Addition of the first 20 amino acids of rhodopsin enhances membrane trafficking

  • T4 lysozyme insertion: Stabilizes the receptor structure in the third intracellular loop

  • LUCY (Local Upper Critical Solution Temperature) fusion tags: Enhance functional expression yields

2. Specialized expression hosts:

  • Inducible mammalian cell lines with regulated expression to prevent toxicity

  • Insect cell systems (Sf9, Hi5) with optimized membrane protein expression capacity

  • Yeast systems engineered for GPCR expression (P. pastoris strains with modified secretory pathway)

3. Chaperone co-expression:

Co-expression with molecular chaperones such as RTP1S (Receptor Transporting Protein 1, Short) and Ric-8B significantly improves plasma membrane localization and functional expression of olfactory receptors.

4. Post-translational modification considerations:

Analysis of potential N-linked glycosylation sites in OR12D3 and creation of optimized constructs that preserve essential modifications while removing sites that might cause heterogeneity.

What quality control parameters should be established for recombinant OR12D3 preparations?

Rigorous quality control is essential for meaningful research with recombinant OR12D3. The following parameters should be systematically evaluated:

Quality ParameterMethodologyAcceptance Criteria
PuritySDS-PAGE, Western blot>70-80% as determined by densitometry
HomogeneityAnalytical SEC (HPLC)Single major peak with minimal aggregation
Structural integrityCircular dichroism spectroscopyCharacteristic α-helical signature of 7TM domains
Functional activityLigand binding assaysDose-dependent response to known ligands
Post-translational modificationsMass spectrometryVerification of expected modifications
Membrane integrationProteoliposome reconstitution efficiency>50% successful incorporation

Additional considerations include thermal stability assessment using differential scanning fluorimetry and long-term storage stability monitoring to ensure consistent experimental results across studies.

How can researchers optimize OR12D3 for structural studies?

Structural characterization of olfactory receptors remains challenging due to their inherent flexibility and instability. For OR12D3 structural studies, consider the following specialized approaches:

1. Stabilizing mutations design:

  • Alanine scanning of flexible regions

  • Introduction of disulfide bridges to restrict conformational flexibility

  • Identification of thermostabilizing mutations through directed evolution

2. Lipid environment optimization:

  • Systematic screening of lipid compositions for crystallization trials

  • Bicelle and cubic phase crystallization methods

  • Nanodiscs with defined lipid compositions for cryo-EM studies

3. Antibody-mediated crystallization:

  • Generation of conformationally selective antibodies or nanobodies

  • Co-crystallization with Fab fragments to provide crystal contacts

  • Selection of antibodies that recognize extracellular loops without interfering with structure

4. Advanced expression strategies:

  • Fusion to crystallization chaperones (T4 lysozyme, BRIL)

  • Minimization of flexible regions while maintaining functional integrity

  • Deglycosylation mutants that maintain stability but improve crystallization properties

These approaches require iterative optimization, with functional validation at each step to ensure that structural modifications do not compromise the native properties of OR12D3.

How might OR12D3 research contribute to understanding sensory influences on addictive behaviors?

The association between the OR12D3 Thr97Ile polymorphism and smoking behavior opens intriguing research directions :

1. Sensory-reward pathway integration:

Research methodologies to explore how OR12D3-mediated sensory inputs influence dopaminergic reward circuits could include:

  • Functional neuroimaging studies correlating OR12D3 genotype with brain activation patterns during exposure to cigarette smoke cues

  • Animal models with humanized OR12D3 variants to study reinforcement learning

  • Electrophysiological characterization of sensory neuron-reward pathway connections

2. Olfactory receptor polymorphisms as predictive biomarkers:

  • Prospective studies evaluating whether OR12D3 variants predict smoking initiation or cessation success

  • Development of personalized interventions based on sensory genotypes

  • Integration with other genetic and environmental factors in predictive models

3. Translational opportunities:

The unique association between OR12D3 and smoking suggests novel intervention strategies:

  • Targeted olfactory masking agents designed based on OR12D3 ligand binding properties

  • Sensory-based cessation therapies tailored to specific receptor genotypes

  • Pharmacological modulators of OR12D3 as potential adjuncts to smoking cessation programs

What advanced genomic approaches might further elucidate the role of OR12D3 in human biology?

Several cutting-edge genomic technologies offer promising avenues for deeper understanding of OR12D3 function:

1. Single-cell transcriptomics of the olfactory epithelium:

  • Characterization of OR12D3-expressing neuronal populations

  • Analysis of co-expression patterns with signaling components

  • Developmental trajectory mapping of OR12D3-positive neurons

2. CRISPR-based genetic screens:

  • Genome-wide identification of factors influencing OR12D3 expression

  • Discovery of proteins involved in OR12D3 trafficking and function

  • Systematic analysis of regulatory elements controlling OR12D3 expression

3. Integration with population genomics:

  • Expanded analysis of OR12D3 variants across diverse human populations

  • Investigation of potential selective pressures on OR12D3 polymorphisms

  • Identification of additional phenotypic associations beyond smoking behavior

4. Epigenetic regulation studies:

  • Characterization of the epigenetic landscape governing OR12D3 expression

  • Analysis of environmental factors influencing OR12D3 regulation

  • Investigation of potential transgenerational effects on olfactory receptor gene expression

These approaches would benefit from interdisciplinary collaboration, combining expertise in genomics, neuroscience, biochemistry, and clinical research to fully elucidate the biological significance of OR12D3.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.